Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.5e-06
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 1.2
Type 2 diabetes mellitus 272 0.0 1.2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 9.5e-06

Synonym

Accession A8MYV0
Symbols

Gene

  Ortholog (2)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGTRGPSAPVDTTPAKTIVVYRNGDPFYVGKKFVLSRRRAATFEALLEQLTEQVDVPFGVRRLFTPTRGH      1 - 70
RVLGLDALQAGGKYVAAGRERFKELDYIHIVPRKPAKIRKLKEIKPVVHCDINVPSKWQTYHRISRHINV     71 - 140
FTNGRLFIPPAKIIIPKFSLSDWDIVLATIGEKVFPLGGVRKLFTMNGHLLGDSKDLQDNHFYVAVGLET    141 - 210
FKYFPYWKSPRVPSEVQQRYANVEKNSQRKKKVDSKGKEPCKYDGIPPKTQDSVYYAKEEKKKTLAEPLV    211 - 280
QRGAEGDVYKAPTPSKETQGALDVKEEHNVQLEVPVDQAESSCDKHCCHNFAYNKHIHKFWLPVILISID    281 - 350
FEAVE                                                                     351 - 355
//

Text Mined References (6)

PMID Year Title