Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Nonsyndromic deafness 137 3.492 1.7

Expression

AA Sequence

MAGGSPAAKRVVVYRNGDPFFPGSQLVVTQRRFPTMEAFLCEVTSAVQAPLAVRALYTPCHGHPVTNLAD      1 - 70
LKNRGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGRQLPAGAPSYIHVFRNGDLV     71 - 140
SPPFSLKLSQAASQDWETVLKLLTEKVKLQSGAVCKLCTLEGLPLSAGKELVTGHYYVAVGEDEFKDLPY    141 - 210
LELLVPSPSLPRGCWQPPGSKSRPHRQGAQGHRAQVTQPSPKEPDRIKPSAFYARPQQTIQPRSKLPTLS    211 - 280
FPSGVIGVYGAPHRRKETAGALEVADDEDTQTEEPLDQRAAQIVEEALSLENQPGAGAAISASAPALPS     281 - 349
//

Text Mined References (7)

PMID Year Title