Property Summary

NCBI Gene PubMed Count 53
PubMed Score 176.93
PubTator Score 213.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Liver neoplasms 108
Disease Target Count P-value
psoriasis 6685 7.8e-05
fibroadenoma 557 4.7e-03
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
fibroadenoma 1.800 4.7e-03
psoriasis -3.700 7.8e-05

Gene RIF (32)

PMID Text
25879571 These findings imply that DCD promotes breast tumorigenesis via modulation of ERBB signaling pathways
25673161 Reduced DCD concentration in sweat in patients with inflammatory acne may permit proliferation of P. acnes in pilosebaceous units, resulting in progression of inflammatory acne.
25055737 Dermcidin binds platelets and may inhibit the therapeutic action of aspirin following acute myocardial infarction.
24969620 Data indicate that Y-P30/dermcidin expressed in placentas of first trimester pregnancies.
24562771 Increased Dermcidin was also detected with immunoblotting.
23426625 Crystal structure and functional mechanism of a human antimicrobial membrane channel
22588119 major binding partners of LEKTI were found to be the antimicrobial peptide dermcidin and the serine protease cathepsin G and no kallikreins.
22262861 Structure-activity analysis of the dermcidin-derived peptide DCD-1L, an anionic antimicrobial peptide present in human sweat.
21397687 revealed that Nck1 SH2 domain binds to the phosphotyrosine residue at position 20 (Y20) of the DCD
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20837461 There was a significant correlation between weight loss and survival in the PIF-positive non-small-cell lung cancer patients.
20809104 dermcidin was a novel platelet aggregating agent, and potentiated the ADP induced thrombosis in the animal model as well as acutely inhibited glucose induced insulin synthesis.
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20510021 Data show that dermcidin adopts a flexible amphipathic alpha-helical structure with a helix-hinge-helix motif, which is a common molecular fold among antimicrobial peptides.
19833888 Observational study of gene-disease association. (HuGE Navigator)
19720844 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19703016 IRAK-4, which is essential for virtually all TLR signalling, was suppressed, whereas the precursor for the antibiotic peptide Dermcidin was up-regulated in HIV-infected cells.
19670153 Observational study of gene-disease association. (HuGE Navigator)
19020323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18714373 Observational study of gene-disease association. (HuGE Navigator)
18599487 pleiotrophin (PTN) and syndecan-2 and -3 as direct binding partners of Y-P30.
18594538 Expression of dermcidin in human primary tumours appears highly variable and is not induced substantially by hypoxia/oxidative stress in cell line model systems
18403914 There is a growing body of evidence illustrating dermcidin as an oncogene and its Y-P30 subunite as a survival factor (Review)
18058718 These data suggest that the disorder and order transition may be relevant for some biological functions of PIF/DCD.
17626247 Dermcidin is a proliferation and survival factor in prostate cancer cells subjected to stressors found in the prostate cancer microenvironment.
17448443 This work suggests that DCD might participate in the regulation of placental function by means of modulating the proteolytic cascades on the trophoblastic cell surface.
16685272 Dermcidin may function as an oncogene in hepatic as well as breast cells; Glycosylation is not required, but the importance of asparagine residues suggests a role for the proteolysis-inducing factor core peptide domain.
16354654 Functional analysis indicated that proteolytic processing of DCD-1L by Cathepsin D in human sweat modulates the innate immune defense of human skin.
16142329 NF-kappaB and STAT3 are activated by proteolysis inducing factor in human Kupffer cells and monocytes
15944307 Reduced expression of dermcidin in sweat of patients with atopic dermatitis may contribute to the high susceptibility of these patients to skin infections and altered skin colonization with Staphylococcus aureus.
15670776 Our results confirmed previous findings indicating that dermcidin-1L could have promising therapeutic potentials and shed new light on the structure-function relationship of dermcidin-1L.
11694882 identified as antibiotic peptide secreted by sweat glands

AA Sequence

MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL      1 - 70
DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL                                   71 - 110
//

Text Mined References (58)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25879571 2015 Dermcidin exerts its oncogenic effects in breast cancer via modulation of ERBB signaling.
25673161 2015 Reduced expression of dermcidin, a peptide active against propionibacterium acnes, in sweat of patients with acne vulgaris.
25416956 2014 A proteome-scale map of the human interactome network.
25055737 2014 Dermcidin isoform-2 induced nullification of the effect of acetyl salicylic acid in platelet aggregation in acute myocardial infarction.
24969620 2014 Analysis of Y-P30/Dermcidin expression and properties of the Y-P30 peptide.
24562771 2014 Dermcidin expression is associated with disease progression and survival among breast cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23426625 2013 Crystal structure and functional mechanism of a human antimicrobial membrane channel.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22588119 2012 The identification of a new role for LEKTI in the skin: The use of protein 'bait' arrays to detect defective trafficking of dermcidin in the skin of patients with Netherton syndrome.
22262861 2012 Structure-activity analysis of the dermcidin-derived peptide DCD-1L, an anionic antimicrobial peptide present in human sweat.
21397687 2011 Identification of Dermcidin as a novel binding protein of Nck1 and characterization of its role in promoting cell migration.
21269460 2011 Initial characterization of the human central proteome.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20837461 2010 Expression and clinicopathologic significance of proteolysis-inducing factor in non-small-cell lung cancer: an immunohistochemical analysis.
20809104 2011 The appearance of dermcidin isoform 2, a novel platelet aggregating agent in the circulation in acute myocardial infarction that inhibits insulin synthesis and the restoration by acetyl salicylic acid of its effects.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20510021 2010 Analysis of the solution structure of the human antibiotic peptide dermcidin and its interaction with phospholipid vesicles.
19833888 2010 Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function.
19720844 2009 Use of multiple metabolic and genetic markers to improve the prediction of type 2 diabetes: the EPIC-Potsdam Study.
19703016 2009 HIV induces both a down-regulation of IRAK-4 that impairs TLR signalling and an up-regulation of the antibiotic peptide dermcidin in monocytic cells.
19670153 2010 Lack of significant effects of the type 2 diabetes susceptibility loci JAZF1, CDC123/CAMK1D, NOTCH2, ADAMTS9, THADA, and TSPAN8/LGR5 on diabetes and quantitative metabolic traits.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19020323 2008 Genotype score in addition to common risk factors for prediction of type 2 diabetes.
18714373 2008 Novel meta-analysis-derived type 2 diabetes risk loci do not determine prediabetic phenotypes.
18599487 2008 The survival-promoting peptide Y-P30 enhances binding of pleiotrophin to syndecan-2 and -3 and supports its neuritogenic activity.
18594538 2008 Variation in dermcidin expression in a range of primary human tumours and in hypoxic/oxidatively stressed human cell lines.
18403914 2008 The dermcidin gene in cancer: role in cachexia, carcinogenesis and tumour cell survival.
18372903 2008 Meta-analysis of genome-wide association data and large-scale replication identifies additional susceptibility loci for type 2 diabetes.
18058718 2007 Prediction and biochemical characterization of intrinsic disorder in the structure of proteolysis-inducing factor/dermcidin.
17626247 2007 Dermcidin expression confers a survival advantage in prostate cancer cells subjected to oxidative stress or hypoxia.
17448443 2007 Identification of dermcidin in human gestational tissue and characterization of its proteolytic activity.
17373842 2007 HDM2-binding partners: interaction with translation elongation factor EF1alpha.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16685272 2006 Dermcidin expression in hepatic cells improves survival without N-glycosylation, but requires asparagine residues.
16354654 2006 Cathepsin D is present in human eccrine sweat and involved in the postsecretory processing of the antimicrobial peptide DCD-1L.
16142329 2005 The cachectic mediator proteolysis inducing factor activates NF-kappaB and STAT3 in human Kupffer cells and monocytes.
15944307 2005 Deficiency of dermcidin-derived antimicrobial peptides in sweat of patients with atopic dermatitis correlates with an impaired innate defense of human skin in vivo.
15670776 2005 Functional and structural characterization of recombinant dermcidin-1L, a human antimicrobial peptide.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355918 2004 Characterization of a human homologue of proteolysis-inducing factor and its role in cancer cachexia.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14978112 2004 Postsecretory processing generates multiple cathelicidins for enhanced topical antimicrobial defense.
12953101 2003 A neural survival factor is a candidate oncogene in breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429208 2002 Identification of the human cDNA for new survival/evasion peptide (DSEP): studies in vitro and in vivo of overexpression by neural cells.
11694882 2001 Dermcidin: a novel human antibiotic peptide secreted by sweat glands.
10833321 2000 Calreticulin binding and other biological activities of survival peptide Y-P30 including effects of systemic treatment of rats.
9736629 1998 Identification of a survival-promoting peptide in medium conditioned by oxidatively stressed cell lines of nervous system origin.
9139670 1997 Structural analysis of a tumor-produced sulfated glycoprotein capable of initiating muscle protein degradation.
8602222 1996 Characterization of a cancer cachectic factor.