Property Summary

NCBI Gene PubMed Count 105
PubMed Score 98.94
PubTator Score 380.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma -2.100 9.2e-07
sonic hedgehog group medulloblastoma 3.500 7.1e-04
medulloblastoma, large-cell 1.900 1.8e-04
lung adenocarcinoma -1.500 5.7e-11
pilocytic astrocytoma 1.400 1.2e-02
lung carcinoma -2.000 4.1e-17
non-small cell lung carcinoma -1.300 1.1e-23
pituitary cancer 1.200 3.2e-02
psoriasis -2.300 2.7e-36

Gene RIF (69)

PMID Text
27096627 The study identified DCC as a differentially expressed gene and clustered meningiomas into DCC low expression (3 grade I and 3 grade II tumors), DCC medium expression (2 grade I and 1 grade II tumors), and DCC high expression (5 grade I tumors) groups.
26710849 Data suggest that, in response to netrin-1/netrin receptor (DCC) signaling, p120RasGAP is recruited to growth cones and supports axon outgrowth; p120RasGAP Src homology 2 domains exhibit scaffolding properties sufficient to support axon outgrowth.
26390996 By analyzing multiple myeloma-derived cell lines and patient-derived primary CD138-positive plasma cells ... authors show for the first time that transcriptional dysregulation of DCC is involved in the progression of plasma cell malignancy.
26345965 the transfected DCC gene can suppress cell proliferation and lead to downregulation of CEA expression in SW1116 cells.
25950802 NTN1-DCC pathway contains targets of FDA-approved drugs and may offer promise for guiding applied clinical research on preventive and therapeutic interventions for AMD
25881791 Signaling mechanism of the netrin-1 receptor DCC in axon guidance
25813273 DCC mutation correlated with fractionated mirroring in individuals with Congenital mirror movements
25575591 Data show that silencing ezrin-radixin-moesin (ERM) protein expression ablates deleted in colorectal carcinoma protein (DCC)-protein kinase A (PKA) interaction and specifically blocks netrin-induced PKA activity and phosphorylation.
24966904 Migration of CD166 positive progenitor cells to sites of cartilage damage may be directed by regulation of DCC/CREB signaling.
24808016 Three novel truncating mutations of DCC are associated with congenital mirror movements.
23765761 genetic variations in DCC rs714 (A>G) modulate risk of esophageal and gastric cancers in a high-risk Kashmir population.
23637120 EDNRB and/or DCC methylation in salivary rinses compares well to examination by an expert clinician in CRC of oral lesions.
23353777 This study re-affirms the role of plausible tumor suppressor DCC variants, in gallbladder carcinogenesis and the risk haplotype may be explored as a useful marker for gallbladder cancer susceptibility.
23310950 results suggested that cohypermethylation of p14 in combination with DCC and/or CADM1 may be an independent prognostic factor for recurrence in patients with stage I ESCC
22829558 Ethnic Malays is genetically susceptible to H. pylori infection and is possibly mediated through a genetic variation in the DCC gene.
22588384 Netrin-1 and DCC are increased in diseased lumbar intervertebral discs and may play a role in the process of neurovascular growth.
22418395 The results of this study suggested that DCC as a promising novel candidate gene that may contribute to the genetic basis behind individual differences in susceptibility to schizophrenia.
22318345 SNP rs7504990 in the DCC showed genome-wide significant association with gallbladder cancer susceptibility.
21642953 An unexpected binding mode of the DCC peptide to the subdomain C groove of the FERM domain, which is distinct from previously reported beta-beta associations found in radixin-adhesion molecule complexes.
21242494 study reports a novel DCC gene mutation responsible for congenital isolated persistent mirror movements in an Italian family and provide evidence that this entity is genetically heterogeneous
21085126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20609112 our findings might indicate also an important role for DCC and netrin-1 in human foetal central nervous system development
20602751 Observational study of gene-disease association. (HuGE Navigator)
20431009 study found that individuals affected with congenital mirror movements carried protein-truncating mutations in DCC; mutant DCC protein revealed a defect in netrin-1 binding; DCC has an important role in lateralization of the nervous system
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
20150623 DCC methylation was observed in the course of gastric carcinogenesis and disappeared in advanced gastric carcinoma.
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20054719 Lost expression of DCC gene is associated with ovarian cancer.
19826074 DCC receptor is localized to syncytiotrophoblasts and invasive extravillous cytotrophoblasts during the first trimester and at term.
19690890 Observational study of gene-disease association. (HuGE Navigator)
19543899 Alterations in TP53, APC, K-ras, and DCC genes in the non-dysplastic ulcerative colitis and Crohn's disease colon, were analyzed.
19543899 Observational study of gene-disease association. (HuGE Navigator)
19329758 Treatment with the demethylating agent 5-aza-2'-deoxycytidine, but not with the histone deacetylase inhibitor trichostatin A exclusively restored DCC expression in CRC cell lines.
19242752 Aberrant methylation of the netrin-1 receptor genes UNC5C and DCC detected in advanced colorectal cancer.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18922894 the transcriptionally active TAp73alpha tumor suppressor is implicated in the apoptosis induced by netrin-1 in a p53-independent and DCC/ubiquitin-proteasome dependent manner.
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18616430 DCC can be found in raft and non-raft portions of the plasma membrane.
18302152 DCC methylation is a frequent and cancer-specific event in primary ESCCs (esophageal squamous cell carcinoma), suggesting that DCC and associated pathways may represent a new diagnostical therapeutic target.
18054557 study provides evidence that most colorectal cancers have alterations in both UNC5C and DCC netrin receptors; while UNC5C expression is regulated primarily via epigenetic regulation, DCC defects are mediated through allelic deletions
17975119 Observational study of gene-disease association. (HuGE Navigator)
17553164 Overexpression of the DDC gene in the LNCaP prostate cancer cell line leads to differential expression of a total of 35 genes.
17018594 DCC is a putative conditional tumor-suppressor gene that is epigenetically inactivated by promoter hypermethylation in a majority of head-and-neck squamous cell carcinomas.
16971669 Patients with low nuclear DCC expression had a 3-year progression-free survival (PFS) rate of 0% compared with 33% of those with high DCC expression (P = 0.0067).
16762451 Results suggest that DCC could regulate cell adhesion and migration through its association with ERM-M (ezrin/radixin/moesin and merlin) proteins.
16715837 Finds a linkage between the chromosome 18 near marker D18S851 at the third time point and the levels of HDL cholesterol in human males.
16537496 the localization of DCC to lipid rafts is a prerequisite for its proapoptotic activity, both in immortalized cells and in primary neurons
16122883 The present study points to a potential influence of folates in regulating DCC expression at multiple levels involving post-transcriptional pathways.
15811950 DCC in both commissural neurons and immortalized cells, is partially associated with cholesterol- and sphingolipid-enriched membrane domains named lipid rafts.
15722793 DCC expression appears not to be predictive in poor survival outcome in patients with stage II or III colorectal cancer.
15646429 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15574733 DCC binds netrin through the fourth fibronectin type III domain.
15573119 Binding of netrin-1 to its receptors inhibits tumour suppressor p53-dependent apoptosis (review)
15523694 Observational study of gene-disease association. (HuGE Navigator)
15491747 DCC/netrin-1 signaling may commit cells to the transition of endometrial gland architecture or function from a proliferating to a secretory phase.
14631365 Multiple aberrations involving the DCC locus may play a role in the progression of nephroblastomas, and hence confer a poorer prognosis.
14571268 Observational study of gene-disease association. (HuGE Navigator)
12901294 Deletions in this gene are found in colorectal and gastric cancers
12901278 Prognostic significance of the DCC gene protein expression in high-risk resected gastric carcinoma
12810718 DCC binds to netrin, which regulates its interactions with heparin
12787729 data suggest that the codon 201 polymorphism of the DCC gene was a target of LOH, and predicted prognosis in colorectal cancer patients
12432238 loss of DCC expression occurs in some colon adenomas, but is insufficient to drive the adenoma to carcinoma progression.
12060632 Loss of dcc gene expression is associated with acute myelogenous leukemia
11817894 The netrin-1 receptor DCC promotes filopodia formation and cell spreading by activating Cdc42 and Rac1.
11518545 Altered expression of DCC protein is detectable in gastric carcinomas, an event that may have a role in the development of the disease.

AA Sequence

MENSLRCVWVPKLAFVLFGASLFSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLDCSAESDRGVP      1 - 70
VIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPL     71 - 140
RFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQPGDIGIY    141 - 210
RCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVI    211 - 280
QLRSKKYSLLGGSNLLISNVTDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEF    281 - 350
ECTVSGKPVPTVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKP    351 - 420
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVG    421 - 490
NLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTSPTSILITWEPPAYANGPVQG    491 - 560
YRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQNVS    561 - 630
LEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMT    631 - 700
VNGTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAE    701 - 770
TVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDL    771 - 840
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGL    841 - 910
KPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAY    911 - 980
ILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRTLKVEHPDKM    981 - 1050
ANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVI   1051 - 1120
CTRRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVS   1121 - 1190
HSQSETQLGSKSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ   1191 - 1260
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEHSSSEEAPSRT   1261 - 1330
IPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVP   1331 - 1400
TAPEVSEESHKPTEDSANVYEQDDLSEQMASLEGLMKQLNAITGSAF                          1401 - 1447
//

Text Mined References (106)

PMID Year Title
27096627 2016 Microarray Expression Data Identify DCC as a Candidate Gene for Early Meningioma Progression.
26710849 2016 p120RasGAP Protein Mediates Netrin-1 Protein-induced Cortical Axon Outgrowth and Guidance.
26429648 2015 Misregulation of the dependence receptor DCC and its upstream lincRNA, LOC100287225, in colorectal cancer.
26390996 2015 Transcriptional dysregulation of the deleted in colorectal carcinoma gene in multiple myeloma and monoclonal gammopathy of undetermined significance.
26345965 2015 Influence of the DCC gene on proliferation and carcinoembryonic antigen expression in the human colorectal cancer cell line SW1116.
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
25950802 2015 Netrin-1 - DCC Signaling Systems and Age-Related Macular Degeneration.
25881791 2015 Signaling mechanism of the netrin-1 receptor DCC in axon guidance.
25813273 2015 Congenital mirror movements: phenotypes associated with DCC and RAD51 mutations.
25575591 2015 Anchoring of protein kinase A by ERM (ezrin-radixin-moesin) proteins is required for proper netrin signaling through DCC (deleted in colorectal cancer).
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24966904 2014 DCC is expressed in a CD166-positive subpopulation of chondrocytes in human osteoarthritic cartilage and modulates CRE activity.
24808016 2014 Congenital mirror movements: mutational analysis of RAD51 and DCC in 26 cases.
24400119 2014 Defining the ligand specificity of the deleted in colorectal cancer (DCC) receptor.
24009623 2013 Genome-wide association study for biomarker identification of Rapamycin and Everolimus using a lymphoblastoid cell line system.
23765761 2013 Role of genetic variants of deleted in colorectal carcinoma (DCC) polymorphisms and esophageal and gastric cancers risk in Kashmir Valley and meta-analysis.
23637120 2013 EDNRB and DCC salivary rinse hypermethylation has a similar performance as expert clinical examination in discrimination of oral cancer/dysplasia versus benign lesions.
23353777 2013 DCC (deleted in colorectal carcinoma) gene variants confer increased susceptibility to gallbladder cancer (Ref. No.: Gene-D-12-01446).
23310950 2013 Cohypermethylation of p14 in combination with CADM1 or DCC as a recurrence-related prognostic indicator in stage I esophageal squamous cell carcinoma.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
22829558 Deleted in Colorectal Cancer (DCC) gene polymorphism is associated with H. pylori infection among susceptible Malays from the north-eastern region of Peninsular Malaysia.
22588384 2012 Increased expression of netrin-1 and its deleted in colorectal cancer receptor in human diseased lumbar intervertebral disc compared with autopsy control.
22418395 2012 Association between schizophrenia and genetic variation in DCC: a case-control study.
22318345 2012 A genome-wide association study identifies SNP in DCC is associated with gallbladder cancer in the Japanese population.
21642953 2011 Structural basis of cargo recognition by the myosin-X MyTH4-FERM domain.
21529783 2011 A quantitative-trait genome-wide association study of alcoholism risk in the community: findings and implications.
21242494 2011 A novel DCC mutation and genetic heterogeneity in congenital mirror movements.
21085126 2011 SNPs in axon guidance pathway genes and susceptibility for Parkinson's disease in the Korean population.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20609112 2010 Spatio-temporal deleted in colorectal cancer (DCC) and netrin-1 expression in human foetal brain development.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
20434207 2010 Transmembrane receptor DCC associates with protein synthesis machinery and regulates translation.
20431009 2010 Mutations in DCC cause congenital mirror movements.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20150623 2010 Methylation of the DCC gene is lost in advanced gastric cancer.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20054719 2011 Lost expression of DCC gene in ovarian cancer and its inhibition in ovarian cancer cells.
19826074 2010 Characterization and expression of netrin-1 and its receptors UNC5B and DCC in human placenta.
19690890 2009 Genetic analysis of diabetic nephropathy on chromosome 18 in African Americans: linkage analysis and dense SNP mapping.
19616629 2009 Bcl11A/CTIP1 regulates expression of DCC and MAP1b in control of axon branching and dendrite outgrowth.
19543899 2009 Analysis of mutations in TP53, APC, K-ras, and DCC genes in the non-dysplastic mucosa of patients with inflammatory bowel disease.
19329758 2009 Promoter CpG island hypermethylation- and H3K9me3 and H3K27me3-mediated epigenetic silencing targets the deleted in colon cancer (DCC) gene in colorectal carcinogenesis without affecting neighboring genes on chromosomal region 18q21.
19242752 2009 Aberrant methylation of the netrin-1 receptor genes UNC5C and DCC detected in advanced colorectal cancer.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18922894 2008 Netrin-1 induces apoptosis in human cervical tumor cells via the TAp73alpha tumor suppressor.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
18616430 2009 Compartmentalized DCC signalling is distinct from DCC localized to lipid rafts.
18585357 2008 DSCAM is a netrin receptor that collaborates with DCC in mediating turning responses to netrin-1.
18302152 2008 DCC promoter hypermethylation in esophageal squamous cell carcinoma.
18054557 2007 Epigenetic and genetic alterations in Netrin-1 receptors UNC5C and DCC in human colon cancer.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17553164 2007 Androgen-regulated genes differentially modulated by the androgen receptor coactivator L-dopa decarboxylase in human prostate cancer cells.
17018594 2006 Deleted in colorectal cancer is a putative conditional tumor-suppressor gene inactivated by promoter hypermethylation in head and neck squamous cell carcinoma.
16971669 2006 Automated quantitative analysis of DCC tumor suppressor protein in ovarian cancer tissue microarray shows association with beta-catenin levels and outcome in patients with epithelial ovarian cancer.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16762451 2006 DCC regulates cell adhesion in human colon cancer derived HT-29 cells and associates with ezrin.
16715837 2005 Genotype-by-sex interaction in the regulation of high-density lipoprotein: the Framingham Heart Study.
16537496 2006 The dependence receptor DCC requires lipid raft localization for cell death signaling.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16122883 2005 Low expression of reduced folate carrier-1 and folylpolyglutamate synthase correlates with lack of a deleted in colorectal carcinoma mRNA splice variant in normal-appearing mucosa of colorectal carcinoma patients.
15811950 2005 DCC association with lipid rafts is required for netrin-1-mediated axon guidance.
15722793 2005 Prognostic significance of DCC and p27Kip1 in colorectal cancer.
15646429 2004 No association between the Arg201Gly polymorphism of the DCC gene and colorectal cancer.
15574733 2004 Mapping netrin receptor binding reveals domains of Unc5 regulating its tyrosine phosphorylation.
15573119 2004 Netrin-1 and its receptors in tumorigenesis.
15523694 2005 Genotype phenotype correlations in Israeli colorectal cancer patients.
15494734 2004 Activation of FAK and Src are receptor-proximal events required for netrin signaling.
15491747 2004 Expression of DCC and netrin-1 in normal human endometrium and its implication in endometrial carcinogenesis.
14631365 2004 Microsatellite analysis of the DCC gene in nephroblastomas: pathologic correlations and prognostic implications.
14571268 2003 The deleted in colorectal carcinoma (DCC) gene 201 R --> G polymorphism: no evidence for genetic association with autoimmune disease.
12901294 2003 The role of the Deleted Colon Cancer (DCC) gene in colorectal and gastric cancer.
12901278 2003 Prognostic significance of the deleted in colorectal cancer gene protein expression in high-risk resected gastric carcinoma.
12810718 2003 Netrin binds discrete subdomains of DCC and UNC5 and mediates interactions between DCC and heparin.
12787729 2003 Codon 201 polymorphism of DCC gene is a prognostic factor in patients with colorectal cancer.
12509857 2003 The MAZ protein is an autoantigen of Hodgkin's disease and paraneoplastic cerebellar dysfunction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432238 Early loss of deleted in colorectal carcinoma gene transcript detected in a group of benign colon adenomas.
12149262 2002 The adaptor protein Nck-1 couples the netrin-1 receptor DCC (deleted in colorectal cancer) to the activation of the small GTPase Rac1 through an atypical mechanism.
12060632 2002 Loss of DCC gene expression is of prognostic importance in acute myelogenous leukemia.
12011067 2002 Mediation of the DCC apoptotic signal by DIP13 alpha.
11986622 2002 Netrin-1-mediated axon outgrowth requires deleted in colorectal cancer-dependent MAPK activation.
11527412 2001 Interaction of Myc-associated zinc finger protein with DCC, the product of a tumor-suppressor gene, during the neural differentiation of P19 EC cells.
11518545 2001 Potential role and chronology of abnormal expression of the Deleted in Colon Cancer (DCC) and the p53 proteins in the development of gastric cancer.
11248093 2001 The dependence receptor DCC (deleted in colorectal cancer) defines an alternative mechanism for caspase activation.
11048721 2000 Netrin-1-mediated axon outgrowth and cAMP production requires interaction with adenosine A2b receptor.
10719364 2000 Homozygous deletions inactivate DCC, but not MADH4/DPC4/SMAD4, in a subset of pancreatic and biliary cancers.
9950216 1999 Netrin-1: interaction with deleted in colorectal cancer (DCC) and alterations in brain tumors and neuroblastomas.
9858595 1999 Siah-1 N-terminal RING domain is required for proteolysis function, and C-terminal sequences regulate oligomerization and binding to target proteins.
9796814 1998 The DCC gene product induces apoptosis by a mechanism requiring receptor proteolysis.
9334332 1997 Mammalian homologs of seven in absentia regulate DCC via the ubiquitin-proteasome pathway.
8861902 1996 Deleted in Colorectal Cancer (DCC) encodes a netrin receptor.
8834768 1996 Pancreatic cancer: the potential clinical relevance of alterations in growth factors and their receptors.
8570191 1995 DCC expression is altered by multiple mechanisms in brain tumours.
8188295 1994 The DCC gene: structural analysis and mutations in colorectal carcinomas.
8187090 1994 Point mutations and allelic deletion of tumor suppressor gene DCC in human esophageal squamous cell carcinomas and their relation to metastasis.
8109990 1994 [Genetic alterations of human colorectal cancer].
8044801 1994 Expression and alternative splicing of the deleted in colorectal cancer (DCC) gene in normal and malignant tissues.
7926722 1994 The DCC gene product in cellular differentiation and colorectal tumorigenesis.
7674088 1995 The sequential accumulation of genetic alterations characteristic of the colorectal adenoma-carcinoma sequence does not occur between gastric adenoma and adenocarcinoma.
7587124 1994 Studies of the deleted in colorectal cancer gene in normal and neoplastic tissues.
2294591 1990 Identification of a chromosome 18q gene that is altered in colorectal cancers.
1991322 1991 Scrambled exons.