Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.33
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -1.800 9.5e-03
osteosarcoma 2.196 3.6e-05
cystic fibrosis 1.166 1.5e-05
atypical teratoid / rhabdoid tumor -1.400 8.2e-04
primary pancreatic ductal adenocarcinoma 1.904 8.6e-04
intraductal papillary-mucinous adenoma (... 1.700 4.9e-03
pancreatic cancer 2.000 4.1e-03
interstitial cystitis 1.200 1.8e-04
invasive ductal carcinoma 1.326 3.6e-04
lung carcinoma -1.200 5.5e-13
Pick disease -1.100 2.8e-03
gastric carcinoma 1.100 4.7e-02
ovarian cancer 2.700 1.5e-04

Pathway (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of discoidin, CUB and LCCL domain containing 1 (DCBLD1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MVPGARGGGALARAAGRGLLALLLAVSAPLRLQAEELGDGCGHLVTYQDSGTMTSKNYPGTYPNHTVCEK      1 - 70
TITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKELLLNTSEVTVRFESGSHISG     71 - 140
RGFLLTYASSDHPDLITCLERASHYLKTEYSKFCPAGCRDVAGDISGNMVDGYRDTSLLCKAAIHAGIIA    141 - 210
DELGGQISVLQRKGISRYEGILANGVLSRDGSLSDKRFLFTSNGCSRSLSFEPDGQIRASSSWQSVNESG    211 - 280
DQVHWSPGQARLQDQGPSWASGDSSNNHKPREWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFKN    281 - 350
NNSKWKTYKGIVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQTWHQRIALKVELIGCQITQGNDS    351 - 420
LVWRKTSQSTSVSTKKEDETITRPIPSEETSTGINITTVAIPLVLLVVLVFAGMGIFAAFRKKKKKGSPY    421 - 490
GSAEAQKTDCWKQIKYPFARHQSAEFTISYDNEKEMTQKLDLITSDMADYQQPLMIGTGTVTRKGSTFRP    491 - 560
MDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGH    561 - 630
KHSLSSGGFSPVAGVGAQDGDYQRPHSAQPADRGYDRPKAVSALATESGHPDSQKPPTHPGTSDSYSAPR    631 - 700
DCLTPLNQTAMTALL                                                           701 - 715
//

Text Mined References (13)

PMID Year Title
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23478653 2014 A genome-wide association study of survival in small-cell lung cancer patients treated with irinotecan plus cisplatin chemotherapy.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143601 2012 Genome-wide association analysis identifies new lung cancer susceptibility loci in never-smoking women in Asia.
22566634 2012 The genetic architecture of economic and political preferences.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.