Property Summary

NCBI Gene PubMed Count 21
PubMed Score 51.60
PubTator Score 251.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 2.300 2.2e-04
hepatocellular carcinoma 1.300 5.3e-06
pancreatic cancer 1.300 1.9e-03
malignant mesothelioma 1.500 1.1e-04
astrocytic glioma 1.200 4.0e-03
oligodendroglioma 1.600 1.9e-03
psoriasis -1.500 5.3e-05
osteosarcoma 2.972 3.1e-06
ependymoma 1.200 2.4e-12
sonic hedgehog group medulloblastoma 1.600 5.9e-07
medulloblastoma, large-cell 1.400 4.6e-04
primitive neuroectodermal tumor 1.200 7.9e-05
adrenocortical carcinoma 1.097 6.1e-04
primary pancreatic ductal adenocarcinoma 1.329 9.5e-04
tuberculosis and treatment for 6 months -1.600 9.1e-05
Breast cancer 2.500 5.0e-02
pancreatic carcinoma 1.100 3.0e-03
ovarian cancer 1.400 2.2e-05

Gene RIF (4)

PMID Text
25342745 results demonstrate that the molecular chaperone TRiC/CCT is essential for correct protein folding, DYRK1A binding, and nuclear accumulation of WDR68.
21777625 DYRK1A binds specifically to WDR68 in cells; the binding, but not the phosphorylation event, induces the nuclear translocation of WDR68.
20940704 Han11 was required to allow coupling of MEKK1 to DYRK1 and HIPK2.
16887337 that AN11 may be a physiological regulator of GLI1 transcriptional activity

AA Sequence

MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYP      1 - 70
TTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSS     71 - 140
IDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLE    141 - 210
HSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSC    211 - 280
HICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV            281 - 342
//

Text Mined References (24)

PMID Year Title
27307198 2016 The adaptor protein DCAF7 mediates the interaction of the adenovirus E1A oncoprotein with the protein kinases DYRK1A and HIPK2.
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25342745 2014 The molecular chaperone TRiC/CCT binds to the Trp-Asp 40 (WD40) repeat protein WDR68 and promotes its folding, protein kinase DYRK1A binding, and nuclear accumulation.
23864635 2013 Dissection of the C-terminal region of E1A redefines the roles of CtBP and other cellular targets in oncogenic transformation.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
21777625 2011 DYRK1A binds to an evolutionarily conserved WD40-repeat protein WDR68 and induces its nuclear translocation.
21328542 2011 ZNF703 gene amplification at 8p12 specifies luminal B breast cancer.
21269460 2011 Initial characterization of the human central proteome.
20940704 2010 The WD40-repeat protein Han11 functions as a scaffold protein to control HIPK2 and MEKK1 kinase functions.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
16887337 2006 HAN11 binds mDia1 and controls GLI1 transcriptional activity.
16759393 2006 A zebrafish screen for craniofacial mutants identifies wdr68 as a highly conserved gene required for endothelin-1 expression.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14593110 2004 Phosphorylation of Ser640 in muscle glycogen synthase by DYRK family protein kinases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9192870 1997 The an11 locus controlling flower pigmentation in petunia encodes a novel WD-repeat protein conserved in yeast, plants, and animals.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.