Property Summary

NCBI Gene PubMed Count 14
PubMed Score 53.58
PubTator Score 15.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.500 6.5e-03
ependymoma -1.200 1.5e-02
glioblastoma -1.700 2.5e-06
oligodendroglioma -1.400 8.1e-17
medulloblastoma -2.100 2.7e-07
atypical teratoid / rhabdoid tumor -1.700 3.0e-06
medulloblastoma, large-cell -2.100 3.2e-05
primitive neuroectodermal tumor -1.800 5.8e-05
intraductal papillary-mucinous adenoma (... 1.400 2.6e-05
adult high grade glioma -1.300 3.2e-02
ovarian cancer 1.700 2.7e-03

Synonym

Accession Q58WW2 A2A295 B4DNB8 Q7L8I0 Q8IXH3 Q8TB19
Symbols NRIP
ARCAP
IQWD1
PC326
MSTP055
1200006M05Rik

Gene

PANTHER Protein Class (2)

PDB

3I7O  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
24222117 High IQWD1 expression is associated with breast cancer.
22177699 NRIP enhances HPV 16 gene expression via interaction with either GR or viral E2.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
18673574 A survey results showed that ten cancer cases were revealed to express the NRIP in six malignancies, but not all of these specific tumor types consistently showed positive NRIP expression.
17984071 NRIP plays a feed-forward role enhancing androgen receptor (AR)-driven NRIP promoter activity via NRIP forming a complex with AR to protect AR protein from proteasome degradation.
15784617 NRIP interacts with either androgen or glucocorticoid receptors

AA Sequence

MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRREFIQRLKLEATLNVHDGCVNTICWNDTGEYILSGS      1 - 70
DDTKLVISNPYSRKVLTTIRSGHRANIFSAKFLPCTNDKQIVSCSGDGVIFYTNVEQDAETNRQCQFTCH     71 - 140
YGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSCTKEDCKDDILINCRRAATSVAICPPIPYYLAVG    141 - 210
CSDSSVRIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLNNKSCRVTSLCYSEDGQEILVSYSSDYIYLF    211 - 280
DPKDDTARELKTPSAEERREELRQPPVKRLRLRGDWSDTGPRARPESERERDGEQSPNVSLMQRMSDMLS    281 - 350
RWFEEASEVAQSNRGRGRSRPRGGTSQSDISTLPTVPSSPDLEVSETAMEVDTPAEQFLQPSTSSTMSAQ    351 - 420
AHSTSSPTESPHSTPLLSSPDSEQRQSVEASGHHTHHQSDNNNEKLSPKPGTGEPVLSLHYSTEGTTTST    421 - 490
IKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDVTKYQEGVSAENPV    491 - 560
ENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQ    561 - 630
FQTEATGPSAHEETSTRDSALQDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRKERKEMEELD    631 - 700
TLNIRRPLVKMVYKGHRNSRTMIKEANFWGANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCLQPH    701 - 770
PFDPILASSGIDYDIKIWSPLEESRIFNRKLADEVITRNELMLEETRNTITVPASFMLRMLASLNHIRAD    771 - 840
RLEGDRSEGSGQENENEDEE                                                      841 - 860
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24222117 2013 Identification of androgen-responsive microRNAs and androgen-related genes in breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22177699 2012 NRIP enhances HPV gene expression via interaction with either GR or E2.
22037555 2011 Common variants on 8p12 and 1q24.2 confer risk of schizophrenia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18673574 2008 Nuclear Receptor Interaction Protein (NRIP) expression assay using human tissue microarray and immunohistochemistry technology confirming nuclear localization.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17984071 2008 Nuclear receptor interaction protein, a coactivator of androgen receptors (AR), is regulated by AR and Sp1 to feed forward and activate its own gene expression through AR protein stability.
16964240 2006 Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15784617 2005 NRIP, a novel nuclear receptor interaction protein, enhances the transcriptional activity of nuclear receptors.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.