Property Summary

NCBI Gene PubMed Count 17
PubMed Score 54.72
PubTator Score 15.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 3.2e-02
astrocytic glioma -1.500 6.5e-03
atypical teratoid / rhabdoid tumor -1.700 3.0e-06
ependymoma -1.200 1.5e-02
glioblastoma -1.700 2.5e-06
group 4 medulloblastoma -1.500 9.3e-03
intraductal papillary-mucinous adenoma (... 1.400 2.6e-05
medulloblastoma, large-cell -2.100 3.2e-05
oligodendroglioma -1.400 8.1e-17
ovarian cancer -1.300 2.0e-04
primitive neuroectodermal tumor -1.800 5.8e-05

Gene RIF (7)

AA Sequence

MSRGGSYPHLLWDVRKRSLGLEDPSRLRSRYLGRREFIQRLKLEATLNVHDGCVNTICWNDTGEYILSGS      1 - 70
DDTKLVISNPYSRKVLTTIRSGHRANIFSAKFLPCTNDKQIVSCSGDGVIFYTNVEQDAETNRQCQFTCH     71 - 140
YGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSCTKEDCKDDILINCRRAATSVAICPPIPYYLAVG    141 - 210
CSDSSVRIYDRRMLGTRATGNYAGRGTTGMVARFIPSHLNNKSCRVTSLCYSEDGQEILVSYSSDYIYLF    211 - 280
DPKDDTARELKTPSAEERREELRQPPVKRLRLRGDWSDTGPRARPESERERDGEQSPNVSLMQRMSDMLS    281 - 350
RWFEEASEVAQSNRGRGRSRPRGGTSQSDISTLPTVPSSPDLEVSETAMEVDTPAEQFLQPSTSSTMSAQ    351 - 420
AHSTSSPTESPHSTPLLSSPDSEQRQSVEASGHHTHHQSDNNNEKLSPKPGTGEPVLSLHYSTEGTTTST    421 - 490
IKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDVTKYQEGVSAENPV    491 - 560
ENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQ    561 - 630
FQTEATGPSAHEETSTRDSALQDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRKERKEMEELD    631 - 700
TLNIRRPLVKMVYKGHRNSRTMIKEANFWGANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCLQPH    701 - 770
PFDPILASSGIDYDIKIWSPLEESRIFNRKLADEVITRNELMLEETRNTITVPASFMLRMLASLNHIRAD    771 - 840
RLEGDRSEGSGQENENEDEE                                                      841 - 860
//

Text Mined References (26)

PMID Year Title