Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.100 2.7e-07
cutaneous lupus erythematosus -1.300 4.9e-04
psoriasis -2.100 3.6e-04
osteosarcoma -1.415 8.9e-04
glioblastoma 1.200 1.6e-04
sonic hedgehog group medulloblastoma 2.100 4.4e-07
medulloblastoma, large-cell 1.300 5.6e-05
primitive neuroectodermal tumor 1.700 2.8e-03
acute quadriplegic myopathy 1.106 3.0e-05
intraductal papillary-mucinous carcinoma... 1.300 7.0e-03
lung cancer 1.700 6.6e-04
atypical teratoid/rhabdoid tumor 1.200 1.7e-03
aldosterone-producing adenoma -1.036 1.8e-02
Breast cancer -1.100 3.3e-07
ovarian cancer 1.200 6.3e-03

Synonym

Accession Q9NXF7 B3KPB7
Symbols C4orf30

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
22190034 HIV-1 Tat is identified to have a physical interaction with DDB1 and CUL4 associated factor 16 (DCAF16) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MGPRNPSPDHLSESESEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTTWKPLN      1 - 70
PNSWLYHAKLLDPSTPVHILREIGLRLSHCSHCVPKLEPIPEWPPLASCGVPPFQKPLTSPSRLSRDHAT     71 - 140
LNGALQFATKQLSRTLSRATPIPEYLKQIPNSCVSGCCCGWLTKTVKETTRTEPINTTYSYTDFQKAVNK    141 - 210
LLTASL                                                                    211 - 216
//

Text Mined References (8)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.