Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.106 3.0e-05
aldosterone-producing adenoma -1.036 1.8e-02
atypical teratoid/rhabdoid tumor 1.200 1.7e-03
Breast cancer -1.100 3.3e-07
cutaneous lupus erythematosus -1.300 4.9e-04
glioblastoma 1.200 1.6e-04
group 3 medulloblastoma 1.300 5.1e-03
intraductal papillary-mucinous carcinoma... 1.300 7.0e-03
lung cancer 1.700 6.6e-04
malignant mesothelioma 2.100 2.7e-07
medulloblastoma, large-cell 1.300 5.6e-05
osteosarcoma -1.415 8.9e-04
ovarian cancer 1.200 6.3e-03
primitive neuroectodermal tumor 1.700 2.8e-03
psoriasis -2.100 3.6e-04

Gene RIF (1)

AA Sequence

MGPRNPSPDHLSESESEEEENISYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTTWKPLN      1 - 70
PNSWLYHAKLLDPSTPVHILREIGLRLSHCSHCVPKLEPIPEWPPLASCGVPPFQKPLTSPSRLSRDHAT     71 - 140
LNGALQFATKQLSRTLSRATPIPEYLKQIPNSCVSGCCCGWLTKTVKETTRTEPINTTYSYTDFQKAVNK    141 - 210
LLTASL                                                                    211 - 216
//

Text Mined References (8)

PMID Year Title