Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.93
PubTator Score 3.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.100 4.2e-03
astrocytoma 1.300 4.1e-20
glioblastoma 1.600 8.6e-10
oligodendroglioma 1.300 2.5e-13
osteosarcoma 1.688 3.2e-03
ependymoma 1.200 2.0e-11
group 3 medulloblastoma 1.800 1.2e-05
atypical teratoid/rhabdoid tumor 1.400 2.3e-09
medulloblastoma, large-cell 1.800 2.1e-06
primitive neuroectodermal tumor 1.300 3.9e-05
juvenile dermatomyositis 1.236 9.9e-11
acute quadriplegic myopathy 1.695 4.4e-08
non-small cell lung cancer 1.387 1.9e-18
lung cancer 2.700 2.6e-06
pediatric high grade glioma 1.500 7.1e-09
pilocytic astrocytoma 1.300 1.3e-05
non primary Sjogren syndrome sicca -1.100 2.4e-02
Breast cancer 1.400 1.2e-05
breast carcinoma 1.300 2.7e-20
ductal carcinoma in situ 1.200 3.7e-03
invasive ductal carcinoma 1.800 3.3e-03
ovarian cancer 2.900 4.4e-05

 GO Function (1)

Gene RIF (2)

PMID Text
20601284 This study suggests that non-synonymous WDSOF1 polymorphisms play a role in the genetic susceptibility to osteoporosis.
20601284 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKVKMLSRNPDNYVRETKLDLQRVPRNYDPALHPFEVPREYIRALNATKLERVFAKPFLASLDGHRDGVN      1 - 70
CLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDG     71 - 140
PGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETF    141 - 210
LLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMD    211 - 280
HVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIR    281 - 350
LWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVN    351 - 420
RIKHSKPGSVPLVSEKKKHVVAVVK                                                 421 - 445
//

Text Mined References (12)

PMID Year Title
24754225 2014 Dynamics of WD-repeat containing proteins in SSU processome components.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20601284 2010 Identification of non-synonymous polymorphisms in the WDSOF1 gene as novel susceptibility markers for low bone mineral density in Japanese postmenopausal women.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.