Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.10
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 3.8e-02
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 36 4.634 2.3
Azoospermia 89 3.605 1.8
Disease Target Count
Oculocerebrorenal syndrome 24

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 3.8e-02

Gene RIF (1)

PMID Text
16949367 Functionally characterizes other DDB1- and CUL4-associated factors, including the DCAF12 factor which most closely resembles the product of this gene.

AA Sequence

MAQQQTGSRKRKAPAVEADAESSPSQGLAAADGEGPLLLKRQRRPATYRSMAHYLKVREVGGWGPARLQG      1 - 70
FDGELRGYAVQRLPELLTERQLELGTVNKVFASQWLNSRQVVCGTKCNTLFVVDVESGHIARIPLLRDSE     71 - 140
ARLAQDQQGCGIHAIELNPSKTLLATGGENPNSLAIYQLPSLDPLCLGDRHGHKDWIFAVAWLSDTVAVS    141 - 210
GSRDGTVALWRMDPDKFDDTVAWHSEVGLPVYAHIRPRDVEAIPRAIINPSNRKVRALACGGKNQELGAV    211 - 280
SLDGYFHLWKAGSALSRLLSIRLPYFRDNVCLTYCDDMSVYAVGSHSHVSFLDLRQDQQNIRPLCSREGG    281 - 350
TGVRSLSFYRHIITVGTGQGSLLFYDVRAQKFLEERASATLESSSGPARRKLRLACGRGWLNHNDFWVNY    351 - 420
FGGMEVFPNALYTHCYNWPEMKLFVAGGPLPAGLHGNYAGLWS                               421 - 463
//

Text Mined References (5)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.