Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.38
PubTator Score 3.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 1.3e-04
pancreatic ductal adenocarcinoma liver metastasis 1911 7.9e-04
dermatomyositis 941 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
dermatomyositis -1.100 1.2e-03
osteosarcoma -1.185 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.033 7.9e-04

Gene RIF (5)

AA Sequence

MGSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLRRGQVRLVQGGGAANLQFIQ      1 - 70
ALLDSEEENDRAWDGRLGDRYNPPVDATPDTRELEFNEIKTQVELATGQLGLRRAAQKHSFPRMLHQRER     71 - 140
GLCHRGSFSLGEQSRVISHFLPNDLGFTDSYSQKAFCGIYSKDGQIFMSACQDQTIRLYDCRYGRFRKFK    141 - 210
SIKARDVGWSVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGDTHTALDLRPDERRFAVFSIAVSSDGREV    211 - 280
LGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKPVGA    281 - 350
LAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKL    351 - 420
KLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVS    421 - 490
WHPFEEKIVSSSWDGNLRLWQYRQAEYFQDDMPESEECASAPAPVPQSSTPFSSPQ                  491 - 546
//

Text Mined References (19)

PMID Year Title