Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.95
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6514 1.6e-46

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.800 1.6e-46

Gene RIF (1)

AA Sequence

MLPSAVAAHAGAYWDVVASSALLNLPAAPGFGNLGKSFLIENLLRVGGAPTPRLQPPAPHDPATALATAG      1 - 70
AQLRPLPASPVPLKLCPAAEQVSPAGAPYGTRWAFQVLSPSADSARLPGRAPGDRDCTFQPSAPAPSKPF     71 - 140
LLSTPPFYSACCGGSCRRPASSTAFPREESMLPLLTQDSNSKARRGILRRAVFSEDQRKALEKMFQKQKY    141 - 210
ISKTDRKKLAINLGLKESQVKIWFQNRRMKWRNSKEKEVLSNRCIQEVGLQEDPLSRSALGFPSPCPSIW    211 - 280
DVPQQHSSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLTGAV               281 - 339
//

Text Mined References (4)

PMID Year Title