Property Summary

NCBI Gene PubMed Count 39
PubMed Score 20.70
PubTator Score 24.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.007 1.3e-02
diabetes mellitus -1.200 7.7e-03
pancreatic cancer 1.100 4.6e-03

Protein-protein Interaction (7)

Gene RIF (13)

PMID Text
25715176 The results presented here indicate that targeting IL-1alpha with subcutaneous MABp1 adminisration has a strong potential therapeutic value in treating psoriasis and may provide a novel future treatment of this often devastating disease.
25690657 Data suggest that by binding to both clathrin and F-actin, mammalian actin-binding protein 1 (mAbp1; HIP-55 or SH3P7) is specifically recruited at a late stage of clathrin-coated pits (CCPs) formation, which subsequently recruits dynamin to CCPs.
24912570 HIP-55 expression promoted proliferation, colony formation, migration, and invasion of lung cancer cells and was upregulated in lung cancer cell lines and tumor tissues of lung cancer patients
24668193 Data suggest that HIP-55 could play an important role in the growth and cellular proliferation and HIP-55 dysfunction could be involved in tumorigenesis.
24651461 Data indicate that fourteen phosphorylation sites along the primary structure of hematopoietic progenitor kinase 1 (HPK1)-interacting protein of 55 kDa (HIP-55) rotein were identified.
22450813 mAbp1 is of fundamental importance for spreading and migration under shear stress conditions, which are critical prerequisites for efficient PMN extravasation during inflammation.
18829961 Filamentous actin (F-actin)-binding protein 1 (Abp1/SH3P7/HIP-55) has a profound impact on synaptic organization by making a required functional connection between postsynaptic density components and postsynaptic actin dynamics.
17306257 unexpected role of 3BP2 in endocytic and cytoskeletal regulation through its interaction with CIN85 and HIP-55
16055701 HIP-55 has roles in T-cell proliferation, cytokine production, and immune responses
14729663 HIP-55 is a key novel component of the immunological synapse that modulates T cell activation by connecting actin cytoskeleton and TCRs to gene activation and endocytic processes
14557276 HIP-55 plays a functional role in TCR signaling
12565838 SH3P7 is essential for endocytosis but not lamellipodia formation.
11689006 substrate for caspase cleavage during apoptosis

AA Sequence

MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK      1 - 70
DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY     71 - 140
SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR    141 - 210
ERELREAARREQRYQEQGGEASPQRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPGK    211 - 280
LRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLV    281 - 350
QQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFGM    351 - 420
FPANYVELIE                                                                421 - 430
//

Text Mined References (51)

PMID Year Title
25715176 2015 Open-Label Trial of MABp1, a True Human Monoclonal Antibody Targeting Interleukin 1?, for the Treatment of Psoriasis.
25690657 2015 Mammalian actin-binding protein 1/HIP-55 is essential for the scission of clathrin-coated pits by regulating dynamin-actin interaction.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24912570 2014 Pro-oncogenic function of HIP-55/Drebrin-like (DBNL) through Ser269/Thr291-phospho-sensor motifs.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24668193 2014 Regulation of cell survival by the HIP-55 signaling network.
24651461 2014 Phosphosite mapping of HIP-55 protein in mammalian cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22450813 2012 The mammalian actin-binding protein 1 is critical for spreading and intraluminal crawling of neutrophils under flow conditions.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19768801 2009 NMR solution structures of actin depolymerizing factor homology domains.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18829961 2008 The actin-binding protein Abp1 controls dendritic spine morphology and is important for spine head and synapse formation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17306257 2007 Abl-SH3 binding protein 2, 3BP2, interacts with CIN85 and HIP-55.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
16055701 2005 HIP-55 is important for T-cell proliferation, cytokine production, and immune responses.
15637062 2005 PRAM-1 potentiates arsenic trioxide-induced JNK activation.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14729663 2004 Recruitment of the actin-binding protein HIP-55 to the immunological synapse regulates T cell receptor signaling and endocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557276 2003 The SH3 domain-containing adaptor HIP-55 mediates c-Jun N-terminal kinase activation in T cell receptor signaling.
12913069 2003 Fgd1, the Cdc42 GEF responsible for Faciogenital Dysplasia, directly interacts with cortactin and mAbp1 to modulate cell shape.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12565838 2003 Mammalian actin binding protein 1 is essential for endocytosis but not lamellipodia formation: functional analysis by RNA interference.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11689006 2001 Caspase-mediated cleavage of actin-binding and SH3-domain-containing proteins cortactin, HS1, and HIP-55 during apoptosis.
11595038 2001 Molecular cloning and dendritic localization of rat SH3P7.
10567356 1999 A novel src homology 3 domain-containing adaptor protein, HIP-55, that interacts with hematopoietic progenitor kinase 1.
10087302 1999 Genetic mapping of eight SH3 domain genes on seven mouse chromosomes.
9891087 1999 SH3P7 is a cytoskeleton adapter protein and is coupled to signal transduction from lymphocyte antigen receptors.
9858486 1999 MUC4 and MUC5B transcripts are the prevalent mucin messenger ribonucleic acids of the human endocervix.