Property Summary

NCBI Gene PubMed Count 51
PubMed Score 126.47
PubTator Score 31.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.400 1.6e-03
osteosarcoma 1.443 8.8e-04
group 4 medulloblastoma 2.300 6.1e-08
atypical teratoid / rhabdoid tumor 1.300 2.1e-05
medulloblastoma, large-cell 1.900 1.8e-06
primitive neuroectodermal tumor 1.200 7.0e-05
intraductal papillary-mucinous adenoma (... -1.300 3.0e-04
lung cancer 1.900 1.3e-04
ovarian cancer 1.900 2.9e-05

Pathway (1)

Protein-protein Interaction (6)

Gene RIF (20)

PMID Text
26123582 Exploring the relationship between drebrin and cognitive function may provide insight into the early prevention of cognitive impairment and in the diagnosis and treatment of Alzheimer's disease.
25839164 Drebrin is critical for progranulin-dependent activation of the Akt and MAPK pathways and modulates motility, invasion and anchorage-independent growth in bladder neoplasms.
25496916 Drebrin 1 (DBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24610677 The study compared the proteome profiles of the human colon adenocarcinoma cell line HCT-116 with its metastatic derivative E1. DBN1 was found to be overexpressed in E1 as compared to HCT-116 cells.
24399445 Rab8a and Drebrin E act as key proteins in the regulation of apical trafficking in intestinal epithelial cells.
24346822 In basal cell carcinoma tissues, intense and homogeneous drebrin expression was observed mainly at tumor cell-cell boundaries. In contrast, drebrin was stained only weakly and non-homogeneously in trichoblastoma and trichoepthelioma tissue samples.
23979715 These findings show that drebrin contains a cryptic F-actin-bundling activity regulated by phosphorylation and provide a mechanistic model for microtubule-F-actin coupling.
23926103 drebrin has a role in HIV infection by modulating viral entry, mainly through the control of actin cytoskeleton polymerization in response to HIV-1
23926103 Drebrin 1 (DBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23201135 Drebrin contributes to the maintenance of cell shape, and may play an important role in glioma cell motility.
23166591 Drebrin 1 (DBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22310934 The results of this study showed that Hippocampal drebrin loss in mild cognitive impairment.
22275434 decreasing the drebrin E levels disrupted the normal subapical F-actin-myosin-IIB-betaII-spectrin network and the apical accumulation of EB3, a microtubule-plus-end-binding protein
21497902 High expression of cytoskeletal protein drebrin is associated with TEL/AML1pos B-cell precursor acute lymphoblastic leukemia
21124928 Data show that DBN1, SETMAR and HIG2 are direct transcriptional targets of the SOX11 protein.
20183806 The downregulation of Drebrin in Alzheimer's Disease and Down Syndrome and conversely its upregulation in various carcinomas indicate that Drebrin is an important component of the pathogenesis of multiple diseases.
18806788 Drebrin targets EB3 to coordinate F-actin-microtubule interactions that underlie neuritogenesis.
18338803 the down-regulation of drebrin mRNA expression plays an important role in Alzheimer's disease and is closely related to the progression of the disease
16780834 These data confirm the role of drebrin E2 in the formation of branching processes and further indicate that during cell migration, the protein contributes to retraction of the cell body and the tail but not to lamellipodia formation.
12009525 We found decreased levels of drebrin in frontal and temporal cortex from patients with DS and AD. Reduced drebrin could cause loss of spine plasticity in DS and may be a marker for neurodegenerative disorders.

AA Sequence

MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSV      1 - 70
KDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARL     71 - 140
SSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKALDERLRFEQER    141 - 210
MEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAA    211 - 280
AIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAE    281 - 350
QIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAED    351 - 420
LMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQ    421 - 490
GEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTP    491 - 560
TLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDI    561 - 630
TCWDADPVPEEEEGFEGGD                                                       631 - 649
//

Text Mined References (64)

PMID Year Title
26123582 2015 Drebrin and cognitive impairment.
25839164 2015 A novel role for drebrin in regulating progranulin bioactivity in bladder cancer.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24610677 2014 iTRAQ analysis of colorectal cancer cell lines suggests Drebrin (DBN1) is overexpressed during liver metastasis.
24399445 2014 Drebrin E depletion in human intestinal epithelial cells mimics Rab8a loss of function.
24346822 2014 Expression of drebrin, an actin binding protein, in basal cell carcinoma, trichoblastoma and trichoepithelioma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979715 2013 Drebrin contains a cryptic F-actin-bundling activity regulated by Cdk5 phosphorylation.
23940795 2013 Phosphorylation of the actin binding protein Drebrin at S647 is regulated by neuronal activity and PTEN.
23926103 2013 Actin-binding protein drebrin regulates HIV-1-triggered actin polymerization and viral infection.
23750010 2013 Drebrin preserves endothelial integrity by stabilizing nectin at adherens junctions.
23201135 2013 The role of drebrin in glioma migration and invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22310934 2012 Hippocampal drebrin loss in mild cognitive impairment.
22275434 2012 Apico-basal elongation requires a drebrin-E-EB3 complex in columnar human epithelial cells.
21497902 2011 High expression of cytoskeletal protein drebrin in TEL/AML1pos B-cell precursor acute lymphoblastic leukemia identified by a novel monoclonal antibody.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21124928 2010 Gene expression profiling and chromatin immunoprecipitation identify DBN1, SETMAR and HIG2 as direct targets of SOX11 in mantle cell lymphoma.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20215400 2010 F-actin-binding protein drebrin regulates CXCR4 recruitment to the immune synapse.
20183806 2010 Control of cell shape and plasticity during development and disease by the actin-binding protein Drebrin.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18806788 2008 Targeting of the F-actin-binding protein drebrin by the microtubule plus-tip protein EB3 is required for neuritogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18338803 2008 Decreased drebrin mRNA expression in Alzheimer disease: correlation with tau pathology.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16780834 2006 Dynamics of the actin-binding protein drebrin in motile cells and definition of a juxtanuclear drebrin-enriched zone.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15084279 2004 Drebrin is a novel connexin-43 binding partner that links gap junctions to the submembrane cytoskeleton.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506234 2003 Tuba, a novel protein containing bin/amphiphysin/Rvs and Dbl homology domains, links dynamin to regulation of the actin cytoskeleton.
12761245 2003 Cell biological and biochemical characterization of drebrin complexes in mesangial cells and podocytes of renal glomeruli.
12676529 2003 Coincidence in dendritic clustering and synaptic targeting of homer proteins and NMDA receptor complex proteins NR2B and PSD95 during development of cultured hippocampal neurons.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12009525 2002 Drebrin, a dendritic spine protein, is manifold decreased in brains of patients with Alzheimer's disease and Down syndrome.
11578820 2001 Drebrin expression is increased in spinal motoneurons of rats after axotomy.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10604653 1999 Drebrin is a widespread actin-associating protein enriched at junctional plaques, defining a specific microfilament anchorage system in polar epithelial cells.
10585290 1999 Domain analysis of the actin-binding and actin-remodeling activities of drebrin.
9473484 1998 Interactions of drebrin and gephyrin with profilin.
8838578 1996 Disappearance of actin-binding protein, drebrin, from hippocampal synapses in Alzheimer's disease.
8216329 1993 Molecular cloning of cDNA encoding human drebrin E and chromosomal mapping of its gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7608104 1995 The roles of microfilament-associated proteins, drebrins, in brain morphogenesis: a review.