Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.59
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 9.0e-08
malignant mesothelioma 3163 1.7e-06
medulloblastoma, large-cell 6234 2.4e-05
lung cancer 4473 6.5e-05

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.000 1.7e-06
osteosarcoma -1.334 9.0e-08
medulloblastoma, large-cell 1.400 2.4e-05
lung cancer 2.000 6.5e-05

Gene RIF (3)

PMID Text
19111665 These results indicate that Ddk functions as an upstream regulator to monitor S-phase checkpoint signaling.
15668232 ASKL1 in a complex with Cdc7 may play a role in normal progression of both S and M phases
12065429 Results describe a novel human protein, Drf1, related to both human and yeast Dbf4. Drf1 is a nuclear cell cycle-regulated protein which binds to Cdc7 and activates the kinase.

AA Sequence

MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAI      1 - 70
QQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSV     71 - 140
PLSRGKELLQKAIRNQGSISGGGSGGSSSLLTNARSWGVRILHVDEMMMHVQQLSLASLCVKKQQPKKPE    141 - 210
GTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESK    211 - 280
DGEPSPRSAAHTMPRRKKGYCECCQEAFEELHVHLQSAQHRSFALEAHLYAEVDRIIAQLSHSFADIPFQ    281 - 350
AGLPRWSGSPASDCDPLCPETLHPHQPSHPRAASPRIRKEDSCQASVTQGRAAGQQRWTESLDGVMGPPA    351 - 420
SHTCVSATTLLPALPKGSREQGCLCPCPASFTQSHLVTSLALLPGEWSPAEDMPLHPSQENSFAPADIPV    421 - 490
KGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHDTTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPS    491 - 560
LSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNTPQPFLHCGFLAVDSG                   561 - 615
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19111665 2008 The role of Dbf4/Drf1-dependent kinase Cdc7 in DNA-damage checkpoint control.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17062569 2007 Cdc7 is an active kinase in human cancer cells undergoing replication stress.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15668232 2005 A second human Dbf4/ASK-related protein, Drf1/ASKL1, is required for efficient progression of S and M phases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065429 2002 Drf1, a novel regulatory subunit for human Cdc7 kinase.