Property Summary

NCBI Gene PubMed Count 33
PubMed Score 73.45
PubTator Score 43.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.641 2.0e-03
malignant mesothelioma 2.200 2.6e-07
esophageal adenocarcinoma 1.100 2.1e-02
astrocytoma 1.100 4.3e-09
glioblastoma 1.800 1.2e-07
oligodendroglioma 1.200 1.3e-08
sonic hedgehog group medulloblastoma 2.400 4.0e-07
medulloblastoma, large-cell 1.800 7.9e-06
primitive neuroectodermal tumor 1.800 7.0e-04
adrenocortical carcinoma 1.813 6.9e-05
non-small cell lung cancer 1.677 1.0e-20
intraductal papillary-mucinous carcinoma... 1.500 2.4e-03
intraductal papillary-mucinous neoplasm ... 1.400 6.4e-03
lung cancer 2.000 1.3e-02
colon cancer 1.200 9.6e-03
pediatric high grade glioma 1.800 5.8e-06
primary Sjogren syndrome 1.100 4.6e-03
nasopharyngeal carcinoma 1.300 3.5e-05
ductal carcinoma in situ 1.700 4.8e-04
invasive ductal carcinoma 2.000 1.8e-04
ovarian cancer 1.500 2.6e-04
psoriasis 1.200 1.1e-45

 GO Component (1)

 MGI Phenotype (1)

Gene RIF (18)

PMID Text
24287290 The anti-invasive and cell cycle arrest-inducing effects of nitrogen-containing bisphosphonates are not DBF4 mediated in human breast cancer cells.
22123827 Dbf4 is direct downstream target of ataxia telangiectasia mutated (ATM) and ataxia telangiectasia and Rad3-related (ATR) protein to regulate intra-S-phase checkpoint.
21536671 bipartite interaction between Cdc7 and Dbf4/ASK subunits facilitates ATP binding and substrate recognition by the Cdc7 kinase.
21036905 Dbf4 regulates the Cdc5 Polo-like kinase through a distinct non-canonical binding interaction
19864417 The interaction with LEDGF relieves autoinhibition of Cdc7-ASK kinase, imposed by the C terminus of ASK.
19744312 Data document the role of DBF4 as a key player in nitrogen-containing bisphosphonate-induced cytotoxicity, thus explaining the effects on the cell-cycle.
19111665 These results indicate that Ddk functions as an upstream regulator to monitor S-phase checkpoint signaling.
18714392 increased Cdc7-Dbf4 abundance may be a common occurrence in human malignancies
18536724 A strong origin of replication at the DBF4 promoter locus, which contains two initiation zones, two origin recognition complex (ORC) binding sites and two DNase I-hypersensitive regions, is identified.
18503552 ASK/Dbf4, a novel cell survival gene in melanoma is transcriptionally regulated by E2F1.
18286467 Cdc7/Dbf4 kinase activity inhibition affects specific phosphorylation sites on MCM2 in cancer cells
17768177 There is the differential regulation of a novel gene, namely ASK/Dbf4, in melanoma and suggest that up-regulation of ASK/Dbf4 is a novel molecular determinant with prognostic relevance that confers a proliferative advantage in cutaneous melanoma.
17276990 Overexpression of Dbf4 abrogates the S checkpoint response to ultraviolet radiation but not ionizing radiation.
16899510 Taken together, these results indicate that Cdc7/Dbf4 phosphorylation of MCM2 is essential for the initiation of DNA replication in mammalian cells.
16826239 Cdc7-Dbf4 kinase efficiently phosphorylates p150.
12535533 Results demonstrate a DNA damage checkpoint that targets Cdc7/Dbf4 protein kinase.
12420215 The HuDbf4 gene has of 12 exons over a 33-kb region. The MluI cell-cycle box is needed for core promoter activation. The Sp1 upregulator & HES-1 repressor coordinately determine promoter efficiency. Transcription initiations occur at -220, -235 and -245.
12015319 results suggest that E2F regulates the ASK promoter through an atypical mode of recognition of the target site

AA Sequence

MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKD      1 - 70
LGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPHPSHDGSSFKSPDTVCLSRGK     71 - 140
LLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIEQKKKELYLLKKSSTSVRDGGKRVGSGAQKT    141 - 210
RTGRLKKPFVKVEDMSQLYRPFYLQLTNMPFINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGG    211 - 280
TSIQLQLKEKKKKGYCECCLQKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKR    281 - 350
IKYSVGSLSPVSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS    351 - 420
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASV    421 - 490
HVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQEHLTVQAKAPFHTPPEEPNE    491 - 560
CDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRTEFITQEENRICSSPVQSLLDLFQTSEEKSE    561 - 630
FLGFTSYTEKSGICNVLDIWEEENSDNLLTAFFSSPSTSTFTGF                              631 - 674
//

Text Mined References (45)

PMID Year Title
24287290 2014 The cell cycle arrest and the anti-invasive effects of nitrogen-containing bisphosphonates are not mediated by DBF4 in breast cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22123827 2012 Dbf4 is direct downstream target of ataxia telangiectasia mutated (ATM) and ataxia telangiectasia and Rad3-related (ATR) protein to regulate intra-S-phase checkpoint.
21536671 2011 Molecular mechanism of activation of human Cdc7 kinase: bipartite interaction with Dbf4/activator of S phase kinase (ASK) activation subunit stimulates ATP binding and substrate recognition.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21036905 2010 Dbf4 regulates the Cdc5 Polo-like kinase through a distinct non-canonical binding interaction.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19864417 2010 Transcriptional co-activator LEDGF interacts with Cdc7-activator of S-phase kinase (ASK) and stimulates its enzymatic activity.
19744312 2009 Identification of secondary targets of N-containing bisphosphonates in mammalian cells via parallel competition analysis of the barcoded yeast deletion collection.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19111665 2008 The role of Dbf4/Drf1-dependent kinase Cdc7 in DNA-damage checkpoint control.
18714392 2008 Cdc7-Dbf4 kinase overexpression in multiple cancers and tumor cell lines is correlated with p53 inactivation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18536724 2008 Asymmetric bidirectional replication at the human DBF4 origin.
18503552 2008 Transcriptional regulation of ASK/Dbf4 in cutaneous melanoma is dependent on E2F1.
18286467 2008 Inhibition of Cdc7/Dbf4 kinase activity affects specific phosphorylation sites on MCM2 in cancer cells.
17768177 2007 Identification and functional characterization of ASK/Dbf4, a novel cell survival gene in cutaneous melanoma with prognostic relevance.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17276990 2007 Cdc7-Dbf4 and the human S checkpoint response to UVC.
17062569 2007 Cdc7 is an active kinase in human cancer cells undergoing replication stress.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16899510 2006 Essential role of phosphorylation of MCM2 by Cdc7/Dbf4 in the initiation of DNA replication in mammalian cells.
16826239 2006 The replication kinase Cdc7-Dbf4 promotes the interaction of the p150 subunit of chromatin assembly factor 1 with proliferating cell nuclear antigen.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15374998 2004 Functional interaction between tumor suppressor menin and activator of S-phase kinase.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
15226314 2004 Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12614612 2003 Interaction and assembly of murine pre-replicative complex proteins in yeast and mouse cells.
12535533 2003 An ATR- and Cdc7-dependent DNA damage checkpoint that inhibits initiation of DNA replication.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12420215 2002 Human Dbf4/ASK promoter is activated through the Sp1 and MluI cell-cycle box (MCB) transcription elements.
12015319 2002 A 63-base pair DNA segment containing an Sp1 site but not a canonical E2F site can confer growth-dependent and E2F-mediated transcriptional stimulation of the human ASK gene encoding the regulatory subunit for human Cdc7-related kinase.
10846177 2000 Human Cdc7-related kinase complex. In vitro phosphorylation of MCM by concerted actions of Cdks and Cdc7 and that of a criticial threonine residue of Cdc7 bY Cdks.
10523313 1999 Mammalian Cdc7-Dbf4 protein kinase complex is essential for initiation of DNA replication.
10517317 1999 Identification, characterization and chromosomal localization of the cognate human and murine DBF4 genes.
10373557 1999 A novel growth- and cell cycle-regulated protein, ASK, activates human Cdc7-related kinase and is essential for G1/S transition in mammalian cells.