Property Summary

NCBI Gene PubMed Count 23
PubMed Score 29.55
PubTator Score 14.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis -1.500 1.8e-02
pancreatic cancer -1.200 1.9e-02
Multiple myeloma 1.076 2.1e-02
psoriasis 1.400 9.7e-05
osteosarcoma 2.544 4.2e-07
cystic fibrosis 1.441 1.5e-04
astrocytoma 1.200 3.0e-03
glioblastoma 1.100 5.2e-03
medulloblastoma, large-cell -1.100 8.5e-04
intraductal papillary-mucinous adenoma (... 1.500 1.2e-04
intraductal papillary-mucinous carcinoma... 1.700 6.6e-04
intraductal papillary-mucinous neoplasm ... 1.700 1.3e-03
lung cancer -1.200 1.4e-04
pancreatic carcinoma -1.200 1.9e-02
lung adenocarcinoma 1.086 1.7e-04
spina bifida -1.188 4.7e-02
ovarian cancer -2.100 2.7e-08
Down syndrome 1.200 2.2e-03
dermatomyositis 1.400 1.5e-04

Gene RIF (5)

PMID Text
22792345 methylation of DAZAP2 promoter was involved in downregulation of DAZAP2 in multiple myeloma cells.
22070932 In summary we established a new mechanism of IL17RB regulation-Smurf2 dependent degradation of its adaptor protein DAZAP2.
21274613 Lys residues might play important roles in regulating the intracellular dynamics of the PRTB protein.K153 in human PRTB is essential for its ubiquitin-dependent degradation
18854154 Knockdown of DAZ associated protein 2 (DAZAP2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17935665 DAZAP2 is downregulated in multiple myeloma samples and it may be a signal molecule in multiple myeloma cells. DAZAP2 is involved in the pathogenesis of MM

AA Sequence

MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASL      1 - 70
YLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLA     71 - 140
VMQGANVLVTQRKGNFFMGGSDGGYTIW                                              141 - 168
//

Text Mined References (25)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
22792345 2012 The effects of promoter methylation on downregulation of DAZAP2 in multiple myeloma cell lines.
22771904 2012 Characterizing the neurite outgrowth inhibitory effect of Mani.
22070932 2012 Smurf2 regulates IL17RB by proteasomal degradation of its novel binding partner DAZAP2.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21274613 2011 Evolutionary features and intracellular behavior of the PRTB protein.
19060904 2009 An empirical framework for binary interactome mapping.
17984221 2008 Proline-rich transcript in brain protein induces stress granule formation.
17935665 2007 Molecular features and expression of DAZAP2 in human multiple myeloma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15629043 2004 The structure, expression and function prediction of DAZAP2, a down-regulated gene in multiple myeloma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11342538 2001 Nuclear import/export of hRPF1/Nedd4 regulates the ubiquitin-dependent degradation of its nuclear substrates.
10857750 2000 Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.