Property Summary

NCBI Gene PubMed Count 22
PubMed Score 25.22
PubTator Score 13.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.054 3.4e-07
breast carcinoma 1.600 3.0e-03
osteosarcoma -2.438 2.5e-07
ovarian cancer -1.300 5.4e-06
sonic hedgehog group medulloblastoma 1.100 1.1e-05

Gene RIF (10)

AA Sequence

MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS      1 - 70
RPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVT     71 - 140
EVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRV    141 - 210
VPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGF    211 - 280
PQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYA    281 - 350
GYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR                 351 - 407
//

Text Mined References (30)

PMID Year Title