Property Summary

NCBI Gene PubMed Count 29
PubMed Score 3.90
PubTator Score 5.68

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
26232607 Studies indicate that partial RNA-binding proteins DAZ1/2 deletion was associated wih male infertility, but partial RNA-binding proteins DAZ3/4 deletion was not associated with male infertility.
19223287 All four DAZ genes are expressed in the human testis, and their products are highly polymorphic among men
17416365 AZFc subdeletions do not seem to cause severe impairment of spermatogenesis in Chilean men.
16963411 Observational study of gene-disease association. (HuGE Navigator)
14639527 a common variant of the human Y chromosome lacks the DAZ3/DAZ4 and BPY2.2/BPY2.3 doublets in distal AZFc and thus these genes cannot be required for male fertility

AA Sequence

MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVK      1 - 70
IITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQ     71 - 140
NVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPV    141 - 210
YNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQL    211 - 280
PVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPFQVATGY    281 - 350
QFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTT    351 - 420
GYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD        421 - 486
//

Text Mined References (30)

PMID Year Title
26232607 2015 Impact of partial DAZ1/2 deletion and partial DAZ3/4 deletion on male infertility.
19223287 2009 Polymorphic expression of DAZ proteins in the human testis.
17416365 2007 AZFc partial deletions in Chilean men with severe spermatogenic failure.
16963411 2006 [Study on DAZ gene copy deletion in severe oligozoospermia sperm donor for ICSI].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15066460 2004 Expression profiles of the DAZ gene family in human testis with and without spermatogenic failure.
15066457 2004 Analysis of the DAZ gene family in cryptorchidism and idiopathic male infertility.
14639527 2004 A large AZFc deletion removes DAZ3/DAZ4 and nearby genes from men in Y haplogroup N.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12801575 2003 Partial DAZ deletions in a family with five infertile brothers.
12752250 2003 Polymorphic DAZ gene family in polymorphic structure of AZFc locus: Artwork or functional for human spermatogenesis?
12511597 2003 Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11883873 2002 A novel approach for the analysis of DAZ gene copy number in severely idiopathic infertile men.
11869379 2002 A preliminary report on the implication of RT-PCR detection of DAZ, RBMY1, USP9Y and Protamine-2 mRNA in testicular biopsy samples from azoospermic men.
11694340 2001 Male infertility, genetic analysis of the DAZ genes on the human Y chromosome and genetic analysis of DNA repair.
11688365 [Microdeletion of chromosome Y in male infertility: role of the DAZ gene].
11390979 2001 A gene family required for human germ cell development evolved from an ancient meiotic gene conserved in metazoans.
11095434 2000 Male infertility caused by a de novo partial deletion of the DAZ cluster on the Y chromosome.
11058556 2000 DAZ family proteins exist throughout male germ cell development and transit from nucleus to cytoplasm at meiosis in humans and mice.
10936047 2000 Four DAZ genes in two clusters found in the AZFc region of the human Y chromosome.
10903443 2000 In vivo and in vitro analysis of homodimerisation activity of the mouse Dazl1 protein.
10857750 2000 Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1.
9700189 1998 Evolution of the DAZ gene family suggests that Y-linked DAZ plays little, or a limited, role in spermatogenesis but underlines a recent African origin for human populations.
9321470 1997 The human DAZ genes, a putative male infertility factor on the Y chromosome, are highly polymorphic in the DAZ repeat regions.
8968756 1996 The human autosomal gene DAZLA: testis specificity and a candidate for male infertility.
8896558 1996 The DAZ gene cluster on the human Y chromosome arose from an autosomal gene that was transposed, repeatedly amplified and pruned.
8845845 1996 A murine homologue of the human DAZ gene is autosomal and expressed only in male and female gonads.
8661148 1996 Mouse autosomal homolog of DAZ, a candidate male sterility gene in humans, is expressed in male germ cells before and after puberty.
7670487 1995 Diverse spermatogenic defects in humans caused by Y chromosome deletions encompassing a novel RNA-binding protein gene.