Property Summary

NCBI Gene PubMed Count 66
PubMed Score 174.19
PubTator Score 187.24

Knowledge Summary

Patent

No data available

Gene RIF (48)

PMID Text
26232607 Studies indicate that partial RNA-binding proteins DAZ1/2 deletion was associated wih male infertility, but partial RNA-binding proteins DAZ3/4 deletion was not associated with male infertility.
26149076 Susceptibility of gr/gr rearrangements to azoospermia or oligozoospermia is dependent on DAZ and CDY1 gene copy deletions.
25994570 Overexpression of DAZ1 is associated with breast tumors.
25916124 We did not found any statistically significant genetic association between DAZ alleles and idiopathic male infertility
24935076 genetic association study in Chinese population: Data suggest that combined patterns of copy number abnormality in DAZ1 (deleted in azoospermia 1) and/or BPY2 (basic charge Y-linked protein 2) are associated with spermatogenic impairment/azoospermia.
23696539 genetic association studies in Han population in China: Data suggest that AZF1/DAZ1 duplications underlie genetic predisposition of Y-chromosome haplogroup K* to spermatogenic impairment (azoospermia/oligospermia) in the population studied.
23512232 There appears to be an asociation of DAZ1/DAZ2 deletion with spermatogenic impairment and male infertility in the South Chinese population.
23422238 Report the prevalence of variations in the AZFc region of the human Y chromosome in infertile men.
20663794 Observational study of gene-disease association. (HuGE Navigator)
20170395 The methylation patterns of CpG island (CGI) in the DAZ gene promoter region were different between somatic cells and spermatic cells
20039973 Observational study of gene-disease association. (HuGE Navigator)
19865085 human DAZL (deleted in azoospermia-like) functions in primordial germ-cell formation, whereas closely related genes DAZ and BOULE (also called BOLL) promote later stages of meiosis and development of haploid gametes
19223287 All four DAZ genes are expressed in the human testis, and their products are highly polymorphic among men
19030103 PCR and FISH demonstrated tandem duplication/multiplication of the SRY and DAZ genes in the two Turner Syndrome patients having intact Y chromosome in >85% cells
18440997 AZFc rearrangements/polymorphisms are transmitted to sons and may represent a risk factor for decreased testis function and male subfertility, which needs confirmation in further studies in larger cohorts
18440997 deletions of two DAZ gene copies are compatible with normal spermatogenesis and fertility.
18385127 The expression of DAZ proteins in adult human testes is restricted to the spermatogonia and suggests a premeiotic role.
18326516 Observational study of gene-disease association. (HuGE Navigator)
17881721 Patients with complete Sertoli cell-only syndrome (SCOS) did not exhibit DAZ gene expression.
17609244 The data show no relationship between 'gr/gr' AZC gene deletion and cryptorchidism.
17453684 Quantitative real-time PCR assays of this protein gave positive predictive values of 78 per cent for the recovery of sperm from testicular biopsy.
17416365 AZFc subdeletions do not seem to cause severe impairment of spermatogenesis in Chilean men.
17412880 Observational study of gene-disease association. (HuGE Navigator)
16963411 complete DAZ deletion is a frequent genetic cause of severe oligozoospermia, and DAZ1/DAZ2 deletion is a high risk factor for the disease
16963411 Observational study of gene-disease association. (HuGE Navigator)
16848763 DAZ cannot bind simultaneously to DAZAP1 and poly(A)-binding protein (PABP), and suggest that the phosphorylation-induced dissociation of DAZ and DAZAP1 may allow the former to stimulate translation by interacting with PABP.
16805138 The results showed that DAZ gene activity seems to correspond to the proliferative activity of stem cells of germinal epithelium.
16777954 An association between DAZ haplotypes and Y chromosome haplogroups was found, and data show that the DAZ gene is not under selective constraints and its evolution depends only on the mutation rate.
16674553 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16580401 Observational study of gene-disease association. (HuGE Navigator)
16491269 Observational study of genotype prevalence. (HuGE Navigator)
16275261 DAZ genes are prone to deletions and duplications. Partial DAZ gene deletions are associated with oligozoospermia.
16085382 Additional polymorphisms identified within the DAZ repeat regions of the DAZ genes indicate that sister chromatid exchange plays a significant role in the genesis of deletions, duplications, and polymorphisms of the Y chromosome.
16078663 Observational study of gene-disease association. (HuGE Navigator)
16021857 Observational study of gene-disease association. (HuGE Navigator)
16001084 DAZ activates translationally silent mRNAs during germ cell development through the direct recruitment of polyA-binding proteins.
15571102 Observational study of genotype prevalence. (HuGE Navigator)
15476166 The frequency of partial copy deletion of DAZ gene in Chinese idiopathic azoospermia or severe oligozoospermia patients is much higher, suggesting that the deletion of DAZ1/DAZ2 may be one of the important factors of spermatogenesis damage.
15476166 Observational study of gene-disease association. (HuGE Navigator)
15253135 The deleted in azoospermia (DAZ) are believed to have important function in sperm production, since DAZ is frequently deleted in azoospermic and severy oligozoospermic men.
15066460 Role in spermatogenesis. Decreased DAZ proteins in spermatogenic failure may be due to germ cell loss. Transcription of BOULE, DAZL, and DAZ not altered in degrees of spermatogenic failure. No increase of DAZL or BOULE found in DAZ deletion.
15066457 Loss of only some copies of DAZ is sufficient to lead to severe male infertility, but it is not a frequent finding in cryptorchid men.
12511597 DAZ/DAZL protein can form a stable complex with human PUM2.
12039700 Sertoli cell function is not damaged in patients with AZFc-DAZ deletions and that the strong reduction of germ cells does not affect the FSH-inhibin B feedback loop.
11883873 DAZ gene copy number in severely idiopathic infertile men. Gene deletion of two copies of DAZ (DAZI and 2) was the cause of spermatogenic damage.
11870237 Observational study of gene-disease association. (HuGE Navigator)
11869379 altered transcription in azoospermia
11688365 role in male infertility - review

AA Sequence

MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVK      1 - 70
IITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQ     71 - 140
NVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVG    141 - 210
GIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIR    211 - 280
KQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQ    281 - 350
SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVND    351 - 420
VDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNP    421 - 490
VTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGY    491 - 560
QLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVAT    561 - 630
GYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQV    631 - 700
TTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD                              701 - 744
//

Text Mined References (66)

PMID Year Title
26232607 2015 Impact of partial DAZ1/2 deletion and partial DAZ3/4 deletion on male infertility.
26162009 2015 Isoform-Level Gene Expression Profiles of Human Y Chromosome Azoospermia Factor Genes and Their X Chromosome Paralogs in the Testicular Tissue of Non-Obstructive Azoospermia Patients.
26149076 2015 Susceptibility of gr/gr rearrangements to azoospermia or oligozoospermia is dependent on DAZ and CDY1 gene copy deletions.
25994570 2015 Transcriptome analysis of the cancer/testis genes, DAZ1, AURKC, and TEX101, in breast tumors and six breast cancer cell lines.
25916124 [The association between DAZ T > C polymorphism and idiopathic male infertility risk in north of Iran].
24935076 2014 Gene copy number alterations in the azoospermia-associated AZFc region and their effect on spermatogenic impairment.
23696539 2013 DAZ duplications confer the predisposition of Y chromosome haplogroup K* to non-obstructive azoospermia in Han Chinese populations.
23512232 2013 Association of DAZ1/DAZ2 deletion with spermatogenic impairment and male infertility in the South Chinese population.
23422238 2014 Analysis of DAZ gene expression in a partial AZFc deletion of the human Y chromosome.
20663794 2010 Features of constitutive gr/gr deletion in a Japanese population.
20170395 2010 Lack of association between DAZ gene methylation patterns and spermatogenic failure.
20039973 2010 Differential effect of specific gr/gr deletion subtypes on spermatogenesis in the Chinese Han population.
19865085 2009 Human DAZL, DAZ and BOULE genes modulate primordial germ-cell and haploid gamete formation.
19223287 2009 Polymorphic expression of DAZ proteins in the human testis.
19030103 2008 Startling mosaicism of the Y-chromosome and tandem duplication of the SRY and DAZ genes in patients with Turner Syndrome.
18440997 2008 Sons conceived by assisted reproduction techniques inherit deletions in the azoospermia factor (AZF) region of the Y chromosome and the DAZ gene copy number.
18385127 2008 Restricted expression of the human DAZ protein in premeiotic germ cells.
18326516 2008 Do we need to search for gr/gr deletions in infertile men in a clinical setting?
17881721 2007 Quantification of DDX3Y, RBMY1, DAZ and TSPY mRNAs in testes of patients with severe impairment of spermatogenesis.
17609244 2007 Partial AZFc deletions in infertile men with cryptorchidism.
17453684 Investigation of DAZ and RBMY1 gene expression in human testis by quantitative real-time PCR.
17416365 2007 AZFc partial deletions in Chilean men with severe spermatogenic failure.
17412880 2007 Partial deletions are associated with an increased risk of complete deletion in AZFc: a new insight into the role of partial AZFc deletions in male infertility.
16963411 2006 [Study on DAZ gene copy deletion in severe oligozoospermia sperm donor for ICSI].
16848763 2006 Phosphorylation of the ARE-binding protein DAZAP1 by ERK2 induces its dissociation from DAZ.
16805138 2006 Localization of the DAZ gene expression in seminiferous tubules of patients with spermatogenic disorders.
16777954 2006 DAZ gene copies: evidence of Y chromosome evolution.
16674553 2006 A frequent partial AZFc deletion does not render an increased risk of spermatogenic impairment in East Asians.
16580401 2006 Preliminary study of the relationship between DAZ gene copy deletions and spermatogenic impairment in Chinese men.
16491269 2006 DAZ1/DAZ2 cluster deletion mediated by gr/gr recombination per se may not be sufficient for spermatogenesis impairment: a study of Chinese normozoospermic men.
16275261 2005 Copy number of DAZ genes in infertile men.
16085382 2005 Polymorphisms associated with the DAZ genes on the human Y chromosome.
16078663 2005 [Important genetic etiology of infertile Chinese males: chromosome abnormality and deletion of DAZ gene copy in the AZFc region of Y chromosome].
16021857 2005 No partial DAZ deletions but frequent gene conversion events on the Y chromosome of fertile men.
16001084 2005 The DAZL family proteins are PABP-binding proteins that regulate translation in germ cells.
15571102 2004 Copy number of DAZ genes in Slovenian and Bosnian general population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476166 2004 [Idiopathic male infertility and partial copy deletion of DAZ gene family].
15253135 2004 Distribution of the DAZ gene transcripts in human testis.
15081113 2004 Identification of a novel gene, DZIP (DAZ-interacting protein), that encodes a protein that interacts with DAZ (deleted in azoospermia) and is expressed in embryonic stem cells and germ cells.
15066460 2004 Expression profiles of the DAZ gene family in human testis with and without spermatogenic failure.
15066457 2004 Analysis of the DAZ gene family in cryptorchidism and idiopathic male infertility.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12801575 2003 Partial DAZ deletions in a family with five infertile brothers.
12752250 2003 Polymorphic DAZ gene family in polymorphic structure of AZFc locus: Artwork or functional for human spermatogenesis?
12511597 2003 Human Pumilio-2 is expressed in embryonic stem cells and germ cells and interacts with DAZ (Deleted in AZoospermia) and DAZ-like proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11883873 2002 A novel approach for the analysis of DAZ gene copy number in severely idiopathic infertile men.
11870237 2002 High frequency of DAZ1/DAZ2 gene deletions in patients with severe oligozoospermia.
11869379 2002 A preliminary report on the implication of RT-PCR detection of DAZ, RBMY1, USP9Y and Protamine-2 mRNA in testicular biopsy samples from azoospermic men.
11694340 2001 Male infertility, genetic analysis of the DAZ genes on the human Y chromosome and genetic analysis of DNA repair.
11688365 [Microdeletion of chromosome Y in male infertility: role of the DAZ gene].
11390979 2001 A gene family required for human germ cell development evolved from an ancient meiotic gene conserved in metazoans.
11095434 2000 Male infertility caused by a de novo partial deletion of the DAZ cluster on the Y chromosome.
11058556 2000 DAZ family proteins exist throughout male germ cell development and transit from nucleus to cytoplasm at meiosis in humans and mice.
10936047 2000 Four DAZ genes in two clusters found in the AZFc region of the human Y chromosome.
10903443 2000 In vivo and in vitro analysis of homodimerisation activity of the mouse Dazl1 protein.
10857750 2000 Identification of two novel proteins that interact with germ-cell-specific RNA-binding proteins DAZ and DAZL1.
9700189 1998 Evolution of the DAZ gene family suggests that Y-linked DAZ plays little, or a limited, role in spermatogenesis but underlines a recent African origin for human populations.
9321470 1997 The human DAZ genes, a putative male infertility factor on the Y chromosome, are highly polymorphic in the DAZ repeat regions.
8981970 1997 Expression of DAZ, an azoospermia factor candidate, in human spermatogonia.
8968756 1996 The human autosomal gene DAZLA: testis specificity and a candidate for male infertility.
8896558 1996 The DAZ gene cluster on the human Y chromosome arose from an autosomal gene that was transposed, repeatedly amplified and pruned.
8845845 1996 A murine homologue of the human DAZ gene is autosomal and expressed only in male and female gonads.
8661148 1996 Mouse autosomal homolog of DAZ, a candidate male sterility gene in humans, is expressed in male germ cells before and after puberty.
7670487 1995 Diverse spermatogenic defects in humans caused by Y chromosome deletions encompassing a novel RNA-binding protein gene.