Property Summary

NCBI Gene PubMed Count 18
PubMed Score 20.04
PubTator Score 15.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -1.400 3.9e-02
psoriasis 1.200 5.1e-04
osteosarcoma -1.588 3.5e-02
medulloblastoma, large-cell 1.100 8.3e-04
pancreatic ductal adenocarcinoma liver m... 1.035 6.7e-03
intraductal papillary-mucinous adenoma (... 1.100 6.1e-03
intraductal papillary-mucinous neoplasm ... 2.700 1.9e-04
active Crohn's disease 2.314 1.3e-02
ulcerative colitis 2.900 5.3e-11
pancreatic cancer 1.400 2.2e-04
adult high grade glioma 1.200 5.9e-04
primary Sjogren syndrome 1.500 9.2e-04
subependymal giant cell astrocytoma 1.542 4.3e-03
lung carcinoma -2.200 4.4e-25
spina bifida -1.650 3.7e-02
ductal carcinoma in situ 1.300 3.0e-03
invasive ductal carcinoma 1.500 4.5e-03
ovarian cancer 1.400 2.7e-09

Gene RIF (3)

PMID Text
21930970 we propose a role for Bam32 in the signaling of MHC class I molecules in professional Ag-presenting DC for the regulation of CD8(+) T cell activation.
15494510 BAM32 works downstream of Src family protein tyrosine kinases and functions to link B cell antigen receptor signals with antigen-processing pathways in B cells.
15247305 novel phosphorylation-dependent function of Bam32 in regulating Rac1 activation and actin remodeling.

AA Sequence

MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLY      1 - 70
SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYE     71 - 140
SVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDL    141 - 210
TECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK    211 - 280
//

Text Mined References (19)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
21930970 2011 The adaptor protein Bam32 in human dendritic cells participates in the regulation of MHC class I-induced CD8+ T cell activation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17823121 2007 Mechanistic basis of differential cellular responses of phosphatidylinositol 3,4-bisphosphate- and phosphatidylinositol 3,4,5-trisphosphate-binding pleckstrin homology domains.
15494510 2004 The B lymphocyte adaptor molecule of 32 kilodaltons (Bam32) regulates B cell antigen receptor internalization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247305 2004 The adaptor protein Bam32 regulates Rac1 activation and actin remodeling through a phosphorylation-dependent mechanism.
14563325 2003 Bam32 links the B cell receptor to ERK and JNK and mediates B cell proliferation but not survival.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12101241 2002 TAPP1 and TAPP2 are targets of phosphatidylinositol 3-kinase signaling in B cells: sustained plasma membrane recruitment triggered by the B-cell antigen receptor.
11781373 2002 The B lymphocyte adaptor molecule of 32 kD (Bam32) regulates B cell antigen receptor signaling and cell survival.
11524430 2001 Src family kinases mediate receptor-stimulated, phosphoinositide 3-kinase-dependent, tyrosine phosphorylation of dual adaptor for phosphotyrosine and 3-phosphoinositides-1 in endothelial and B cell lines.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
11001876 2000 Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities.
10983984 2000 Structural basis for discrimination of 3-phosphoinositides by pleckstrin homology domains.
10880360 2000 Phosphoinositide 3-kinase-dependent phosphorylation of the dual adaptor for phosphotyrosine and 3-phosphoinositides by the Src family of tyrosine kinase.
10770799 2000 A novel B lymphocyte-associated adaptor protein, Bam32, regulates antigen receptor signaling downstream of phosphatidylinositol 3-kinase.
10432293 1999 DAPP1: a dual adaptor for phosphotyrosine and 3-phosphoinositides.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.