Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.32
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
sonic hedgehog group medulloblastoma 2.900 1.2e-04
glioblastoma 1.700 5.1e-03
adrenocortical carcinoma -4.176 5.8e-06
non-small cell lung cancer 3.061 8.5e-09
fibroadenoma 1.400 2.5e-02
interstitial cystitis -3.000 3.0e-04
cystic fibrosis -2.700 4.0e-03
subependymal giant cell astrocytoma 5.367 9.6e-04
non-inflammatory breast cancer -2.400 7.2e-03
lung carcinoma 3.600 1.0e-44
ovarian cancer 1.600 3.2e-02
pituitary cancer 2.700 3.7e-06
head and neck cancer -2.400 1.8e-03
head and neck cancer and chronic obstruc... -1.300 2.5e-02

Gene RIF (2)

PMID Text
25680934 DAPL1 plays a role in epithelial differentiation and may be involved in apoptotic processes thereby suggesting a possible novel pathway in AMD pathogenesis.
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MANEVQDLLSPRKGGHPPAVKAGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTLDALNDALEKL      1 - 70
NYKFPATVHMAHQKPTPALEKVVPLKRIYIIQQPRKC                                      71 - 107
//

Text Mined References (7)

PMID Year Title
25680934 2015 A Candidate Gene Association Study Identifies DAPL1 as a Female-Specific Susceptibility Locus for Age-Related Macular Degeneration (AMD).
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
15920738 2006 EEDA: a protein associated with an early stage of stratified epithelial differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.