Property Summary

NCBI Gene PubMed Count 39
PubMed Score 50.89
PubTator Score 692.66

Knowledge Summary

Patent (17,139)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.000 1.6e-05
osteosarcoma 1.604 9.4e-04
Gaucher disease type 1 -1.200 1.7e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
26748242 The results revealed mutations caused a significant structural variation in DAPK3, concentrated in flexible loops forming part of the ATP binding pocket which have been associated with very low kinase activity, and the cellular progression towards cancer
26117336 DAPK3 plays a central role in preventing miR-17/miR-20a depletion-induced genome instability and in miR-17/miR-20a overexpression-triggered tumor formation.
25769953 findings suggest that ZIPK plays a role in the progression and completion of cytokinesis through MRLC phosphorylation
25723491 ROCK1 and ZIPK have diverse, but predominantly distinct regulatory functions in vascular SMC and that ROCK1-mediated activation of ZIPK is not involved in most of these functions.
25503649 These findings indicated that ZIPK may also be involved in the regulation of the cell cycle in human cells, by interacting with HsCdc14A.
25304685 Cellular and mouse modeling studies show that DAPK3 is a tumor suppressor gene and is important in early development. Also, its expression is downregulated in more aggressive breast cancer relative to less aggressive and normal patient samples.
24633547 Depletion of ZIPK resulted in impairment of cultured VSMC migration and contraction.
23454120 Interaction of RhoD and ZIP kinase modulates actin filament assembly and focal adhesion dynamics.
23146908 ZIPK has a crucial role in regulation of ubiquitination and degradation of the AR
21487036 Results suggest that DAPK3 is a tumor suppressor in which loss-of-function mutations promote increased cell survival, proliferation, cellular aggregation.
21454679 ZIPK may serve as a transcriptional regulator of canonical Wnt/beta-catenin signaling through interaction with NLK/TCF4.
20854903 The NLS2 of human ZIPK functions the nucleus-directing motif, but only upon dephosphorylation of the adjacent T299 residue.
20085750 Dlk plays a positive role in modulating death-related signaling pathways.
19117059 ZIPK is a tumor suppresser gene and plays an important role in gastric carcinoma
18515077 These results suggest that UbcH5 regulates ZIPK accumulation in PML-NBs by interacting with ZIPK and stimulating its ubiquitination.
18084323 ZIP kinase plays a crucial role in androgen receptor-mediated transcription.
15910542 The specific expression pattern of TCP10L and interaction with DAPK-3 implies that TCP10L might play crucially important roles in spermatogenesis through its interaction with DAPK-3.
15292222 data identify hZIPK as the unique SMPP-1-associated kinase expressed in human vesicular smooth muscle and support a role for Rho in promoting the hZIPK-MBS interaction
12917339 These results suggest that ZIPK, in collaboration with Daxx and Par-4, mediates a novel nuclear pathway for apoptosis

AA Sequence

MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILRE      1 - 70
IRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDL     71 - 140
KPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL    141 - 210
LSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRR    211 - 280
RNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCH    281 - 350
EDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY    351 - 420
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR                                        421 - 454
//

Text Mined References (51)

PMID Year Title
26748242 2016 Biophysical changes of ATP binding pocket may explain loss of kinase activity in mutant DAPK3 in cancer: A molecular dynamic simulation analysis.
26117336 2015 Oncogenic miR-17/20a Forms a Positive Feed-forward Loop with the p53 Kinase DAPK3 to Promote Tumorigenesis.
25769953 2015 Phosphorylation of myosin II regulatory light chain by ZIP kinase is responsible for cleavage furrow ingression during cell division in mammalian cultured cells.
25723491 2015 The effects of knockdown of rho-associated kinase 1 and zipper-interacting protein kinase on gene expression and function in cultured human arterial smooth muscle cells.
25503649 2015 Zipper-interacting protein kinase interacts with human cell division cycle 14A phosphatase.
25304685 2015 DAPK3 suppresses acini morphogenesis and is required for mouse development.
25226531 2014 Common variation near ROBO2 is associated with expressive vocabulary in infancy.
24633547 2014 ZIPK is critical for the motility and contractility of VSMCs through the regulation of nonmuscle myosin II isoforms.
23454120 2013 Interaction of RhoD and ZIP kinase modulates actin filament assembly and focal adhesion dynamics.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23146908 2013 Zipper-interacting protein kinase is involved in regulation of ubiquitination of the androgen receptor, thereby contributing to dynamic transcription complex assembly.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21487036 2011 Cancer-associated loss-of-function mutations implicate DAPK3 as a tumor-suppressing kinase.
21454679 2011 Zipper-interacting protein kinase (ZIPK) modulates canonical Wnt/beta-catenin signaling through interaction with Nemo-like kinase and T-cell factor 4 (NLK/TCF4).
21408167 2011 New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform.
21169990 2011 Atg1-mediated myosin II activation regulates autophagosome formation during starvation-induced autophagy.
20854903 2011 Phosphorylation-dependent control of ZIPK nuclear import is species specific.
20085750 2010 Link of Dlk/ZIP kinase to cell apoptosis and tumor suppression.
19117059 2009 Downregulation of ZIP kinase is associated with tumor invasion, metastasis and poor prognosis in gastric cancer.
18995835 2008 DAPK-ZIPK-L13a axis constitutes a negative-feedback module regulating inflammatory gene expression.
18515077 2008 Physical and functional interactions between ZIP kinase and UbcH5.
18239682 2008 Activation segment dimerization: a mechanism for kinase autophosphorylation of non-consensus sites.
18084323 2008 ZIP kinase plays a crucial role in androgen receptor-mediated transcription.
17953487 2007 ZIPK: a unique case of murine-specific divergence of a conserved vertebrate gene.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17158456 2007 ROCK1 phosphorylates and activates zipper-interacting protein kinase.
17126281 2006 Novel ZIP kinase isoform lacks leucine zipper.
16756490 2006 The death-associated protein kinases: structure, function, and beyond.
16219639 2005 Physical and functional interactions between STAT3 and ZIP kinase.
15910542 2005 TCP10L is expressed specifically in spermatogenic cells and binds to death associated protein kinase-3.
15611134 2005 Regulation of zipper-interacting protein kinase activity in vitro and in vivo by multisite phosphorylation.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367680 2004 Death-associated protein kinase phosphorylates ZIP kinase, forming a unique kinase hierarchy to activate its cell death functions.
15292222 2004 Identification and characterization of zipper-interacting protein kinase as the unique vascular smooth muscle myosin phosphatase-associated kinase.
15096528 2004 ZIP kinase is responsible for the phosphorylation of myosin II and necessary for cell motility in mammalian fibroblasts.
15001356 2004 Phage-peptide display identifies the interferon-responsive, death-activated protein kinase family as a novel modifier of MDM2 and p21WAF1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685163 2004 Roles of CHOP/GADD153 in endoplasmic reticulum stress.
12917339 2003 ZIP kinase triggers apoptosis from nuclear PML oncogenic domains.
12560483 2003 Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242277 2002 The adapter protein ZIP binds Grb14 and regulates its inhibitory action on insulin signaling by recruiting protein kinase Czeta.
11781833 2001 HeLa ZIP kinase induces diphosphorylation of myosin II regulatory light chain and reorganization of actin filaments in nonmuscle cells.
11384979 2001 Zipper-interacting protein kinase induces Ca(2+)-free smooth muscle contraction via myosin light chain phosphorylation.
10602480 1999 Interaction partners of Dlk/ZIP kinase: co-expression of Dlk/ZIP kinase and Par-4 results in cytoplasmic retention and apoptosis.
10580117 1999 AATF, a novel transcription factor that interacts with Dlk/ZIP kinase and interferes with apoptosis.
10356987 1999 ZIP kinase identified as a novel myosin regulatory light chain kinase in HeLa cells.
9747039 1998 Assignment of the ZIP kinase gene to human chromosome 19p13.3 by somatic hybrid analysis and fluorescence in-situ hybridization.
9488481 1998 ZIP kinase, a novel serine/threonine kinase which mediates apoptosis.