Property Summary

NCBI Gene PubMed Count 18
PubMed Score 158.15
PubTator Score 362.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.033 1.8e-03
esophageal adenocarcinoma 1.100 1.8e-02
posterior fossa group A ependymoma 1.600 1.7e-11
medulloblastoma 1.200 2.4e-06
glioblastoma 1.500 3.4e-03
atypical teratoid/rhabdoid tumor 1.100 3.5e-06
subependymal giant cell astrocytoma 1.840 2.3e-02
ovarian cancer 1.800 4.3e-05
pituitary cancer -1.200 1.8e-04

Pathway (1)

Gene RIF (6)

PMID Text
25530065 DAP1 may have an important role in cell adhesion, migration and growth in the context of breast cancer and has significant associations with the apoptosis pathway.
24270644 DAP1 was found to be correlated with disease progression and long-term survival of the colorectal patients. DAP1 is also a pivotal regulator of the growth and apoptosis and cellular response to chemotherapy agents.
22798505 This study demonstrates an inverse association between DAP1 mRNA levels and tumour stage and clinical outcome in breast cancer
20537536 Mapping of the phosphorylation sites and analysis of phosphorylation mutants indicated that DAP1 is functionally silenced in growing cells through mTOR-dependent phosphorylations on Ser3 and Ser51
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDF      1 - 70
PPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK                                           71 - 102
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25530065 2015 Effect of the knockdown of death-associated protein 1 expression on cell adhesion, growth and migration in breast cancer cells.
24270644 2014 Death associated protein 1 is correlated with the clinical outcome of patients with colorectal cancer and has a role in the regulation of cell death.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22798505 The mRNA expression of DAP1 in human breast cancer: correlation with clinicopathological parameters.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20537536 2010 DAP1, a novel substrate of mTOR, negatively regulates autophagy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16602700 2006 Beyond linker histones and high mobility group proteins: global profiling of perchloric acid soluble proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9916995 1998 Death associated proteins (DAPs): from gene identification to the analysis of their apoptotic and tumor suppressive functions.
8530096 1995 Assignment of DAP1 and DAPK--genes that positively mediate programmed cell death triggered by IFN-gamma--to chromosome regions 5p12.2 and 9q34.1, respectively.
7828849 1995 Identification of a novel serine/threonine kinase and a novel 15-kD protein as potential mediators of the gamma interferon-induced cell death.
1087798 1976 [Effect of antibodies to rat and human cerebral cortex and white matter on heterologous T- and B-cells].