Property Summary

NCBI Gene PubMed Count 123
PubMed Score 76.81
PubTator Score 42.90

Knowledge Summary

Patent

No data available

Gene RIF (141)

PMID Text
26803614 DAOA gene may contribute to the risk for Psychotic disorders and that this gene may play a role as a modulator of executive function.
26539492 pLG72 level being significantly increased in the serum of patients with schizophrenia, have led us to propose that the ROS enhancement in mental diseases may be from the overexpression of pLG72 in brain cells.
26170631 Report in silico analysis of DAOA for the design of inhibitors for treatment of schizophrenia.
25263995 This study suggested that structural lipid alterations in oligodendrocyte glycosynapses are responsible for dysconnectivity in schizophrenia and that increased expression of G72 protein may play a role in the development of abnormal glycosynapses.
25078755 the mitochondrial methionine-R-sulfoxide reductase B2 (MSRB2) is a specific interaction partner of LG72.
25043320 DAOA (or G72) gene encodes for a protein that binds to and activates the D-serine amino acid oxidase that acts as a coactivator of the glycine binding site on the glutamatergic N-methyl D-aspartate (NMDA) receptor.
25031104 There were no regions with significantly reduced FA values in homozygous risk allele carriers.
24447945 DAOA genetic polymorphism were not found to confer a statistically significant increased risk of Schizophrenia, bipolar disorder or depressive disorder.
24417347 Suggest chronic nicotine administration improves cognitive symptoms in G72 mouse model of schizophrenia.
24237903 Data suggest that neuronal LG72 exhibits a rapid turnover (half-life of 25-40 min in U87 glioblastoma cells) and is degraded via proteasome system, albeit not ubiquitinated.
24138986 Its toxic effect on motor neurons can be mediated by expression in motor neurons and it promotes autophagy.
23861766 Cognitive manic symptoms in bipolar disorder associated with polymorphisms in the DAOA and COMT genes.
23632455 htSNPs not associated with transition to psychosis in high risk individuals
23497497 primary analyses of the 6 DAOA gene polymorphisms failed to detect any association with schizophrenia
23495896 No significant epistatic interaction was observed between DAOA and 5HTR1A variants on clinical outcomes in patients with schizophrenia
23337943 study reports G72/G30 expression profiles and behavioral changes in a G72/G30 transgenic mouse model; the transcriptome profile changes and multiple mouse behavioral effects suggest that the G72 gene may play a role in modulating behaviors relevant to psychiatric disorders
23335491 the DAOA gene may confer genetic risk of schizophrenia.
23286827 docking experiment demonstrated DAOA is involved in major amino acid interactions: the residues that interact strongly with the ligand C28H28N3O5PS2 are polar but uncharged (Gln36, Asn38, Thr 122) and non-polar hydrophobic (Ile119, Ser171, Ser21, Ala31).
23092656 Results demonstrate that expression of the human G72/G30 gene locus in mice produces behavioral phenotypes that are relevant to schizophrenia and implicate LG72-induced mitochondrial and synaptic defects as a possible pathomechanism of this disease.
22884423 This study reveled the functional role of the LG72 protein and pinpoints molecular correlates of schizophrenia-like behavior.
22851402 The DAOA gene may confer genetic risk of major depression.
22454242 The results of this study suggested that DAOA gene variation affects dopamine turnover in healthy individuals.
22438288 Significant interactions between the effects of G72 and DAT polymorphisms on activation were evident in several brain areas
22429365 The findings suggest that the DAOA single nucleotide polymorphisms investigated may not affect major depressive disorder or bipolar disorder phenotype, clinical symptoms or other clinical factors.
22239582 A significant 3 way interaction between G72, DAAO and diagnosis is detected in the right middle temporal gyrus (after family-wise error correction), accounting for 8.5% of the individual variance in activation.
22122005 Results suggested that DAOA rs7139958 and rs9558571 SNPs may be associated with more severe baseline positive symptoms in patients with schizophrenia.
21716263 G72 transgenic mice have reduced activity of mitochondrial complex I, with a concomitantly increased production of reactive oxygen species.
21679769 Data suggest that newly synthesized D-amino acid oxidase colocalizes and interacts with pLG72 which appears to be exposed on the external membrane of mitochondria.
21508934 The Arg30Lys DAOA risk variant is associated with a distinct cortical thinning, providing new evidence for the pathophysiological impact of DAOA in schizophrenia.
21443574 This study suggested that DAOA/G72 gene confers susceptibility to both bipolar disorder and schizophrenia , but that different polymorphisms may potentially differentiate between these two disorders.
21215384 The results of this study suggested that deleterious genotypes for DAOA and COMT might contribute to the pathophysiology of schizophrenia.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20957330 Psychosis and relapse in bipolar disorder are related to GRM3, DAOA, and GRIN2B genotype in Caucasian and mixed-ancestry South African pilot study.
20957330 Observational study of gene-disease association. (HuGE Navigator)
20712760 Observational study of gene-disease association. (HuGE Navigator)
20667145 Observational study of gene-disease association. (HuGE Navigator)
20483474 This study did not find DAOA significant associations with schizophrenia. Thus, DAOA genes do not fit the antagonistic pleiotropy model.
20483474 Observational study of gene-disease association. (HuGE Navigator)
20471098 The results of thisn study demonistrated that in individuals with Schizophrenia who carrying rs2391191 A allele had significantly lower brief psychiatric rating scale scores than subjects carrying the G allele at each time point.
20471098 Observational study of gene-disease association. (HuGE Navigator)
20336655 G72 genotype does modulate brain activation during language production on a semantic level in key language areas.
20336655 Observational study of gene-disease association. (HuGE Navigator)
20230869 Observational study of gene-disease association. (HuGE Navigator)
20145586 Observational study of gene-disease association. (HuGE Navigator)
20009237 multivariate regression showed that the rs2153674 genotype accounts for up to 15% of the variance in delusions severity in patients with Alzheimer's disease
20009237 Observational study of gene-disease association. (HuGE Navigator)
20005295 The present data do not support the view of a general modulatory role of G72 on medial temporal lobe brain activity, at least not in the domain of long-term memory encoding and retrieval.
20005295 Observational study of gene-disease association. (HuGE Navigator)
19937977 A homogeneous sample of 280 schizophrenia patients and 230 healthy controls of Hungarian, Caucasian descent were genotyped for polymorphisms in schizophrenia candidate genes NRG1, DTNBP1, RGS4, G72/G30, and PIP5K2A.
19937977 Observational study of gene-disease association. (HuGE Navigator)
19778423 Observational study of gene-disease association. (HuGE Navigator)
19763662 DAOA/G72 is one of the first genes identified to influence the risk of symptom progression of schizophrenia prodromal probands.
19763662 Observational study of gene-disease association. (HuGE Navigator)
19760675 variation in G72 modulates the progressive brain changes that characterize schizophrenia
19689504 Genetic variation at single nucleotide polymorphisms in the G72 gene previously associated with bipolar disorder is related to reductions in temporal pole and amygdala gray matter structure in people with bipolar disorder.
19689504 Observational study of gene-disease association. (HuGE Navigator)
19560517 The results provide further evidence to support that DAOA gene locus is involved in conferring susceptibility to schizophrenia.
19560517 Observational study of gene-disease association. (HuGE Navigator)
19548263 Observational study of gene-disease association. (HuGE Navigator)
19482054 G72 gene may contribute to a predisposition not only to schizophrenia but also to methamphetamine psychosis.
19482054 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19439994 present Scandinavian results do not verify previous associations between the analyzed DTNBP1, NRG1, DAO, DAOA, and GRM3 gene polymorphisms and schizophrenia
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19339914 Observational study of gene-disease association. (HuGE Navigator)
19237267 Observational study of gene-disease association. (HuGE Navigator)
19194963 DAOA may contribute to bipolar susceptibility in some specific families.
19194963 Observational study of gene-disease association. (HuGE Navigator)
19189879 The transgenic mice which expression of the human G72/G30 gene locus in mice produces behavioral phenotypes that are relevant to psychiatric disorders.
19167508 high risk variant of the G72 vulnerability gene for schizophrenia does not necessarily have to negatively affect cognitive abilities
19167508 Observational study of gene-disease association. (HuGE Navigator)
19089835 DAOA is identified as a potential contributor to juvenile-onset mood disorders.
19089835 Observational study of gene-disease association. (HuGE Navigator)
19077230 Lack of demonstrable G72 expression in relevant brain regions does not support a role for G72 in modulation of DAO activity and the pathology of schizophrenia via a DAO-mediated mechanism.
18775646 The G72/G30 complex is considered as one of the most promising candidate genes for both schizophrenia and bipolar disorder.
18584117 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18544534 a decrease in the synaptic concentration of d-serine as the result of an anomalous increase in hDAAO activity related to hypoexpression of pLG72 may represent a molecular mechanism by which hDAAO and pLG72 are involved in schizophrenia susceptibility
18541412 We report a significant effect of DAOA variation on risk for schizophrenia.
18541412 Observational study of gene-disease association. (HuGE Navigator)
18516516 Data show that the specific alleles in the genes for DAOA (G72/G30) reveal associations for each of both affective and schizophrenic disorders in the same direction in some.
18466879 The DAOA gene may play a role in predisposing individuals to a mixed phenotype of psychosis and mania and to impairments in related neuropsychological traits.
18466879 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18423426 These results support the view that genetic variation in the DAOA gene influences hippocampal complex and prefrontal cortex function, an effect that might be particularly prominent in the context of enhanced genetic risk for schizophrenia.
18423426 Observational study of gene-disease association. (HuGE Navigator)
18346999 This is the first study to the authors' knowledge to implicate the G72 locus in the etiology of major depression and neuroticism.
18346999 Observational study of gene-disease association. (HuGE Navigator)
18198266 Observational study of gene-disease association. (HuGE Navigator)
18165970 Some support for the individual involvement of DAO and G72(DAOA)/G30 in the etiology of bipolar disorder.
18165970 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18023149 These results suggest that G72/G30 may influence susceptibility to schizophrenia with weak effects.
18023149 Meta-analysis of gene-disease association. (HuGE Navigator)
17880399 serine racemase and D-amino acid oxidase are expressed in human brain and demonstrate aberrant D-serine metabolism in schizophrenia
17767147 The DAOA ARG30LYS is significant association with poor memory performance in schizophrenia.
17728673 Polymorphisms are not associated with homicidal behavior in korean schizophrenics.
17684499 failure to confirm originally proposed functional interaction between G72 and D-amino acid oxidase (DAO) in two tested cell lines implicating a candidate schizophrenia/bipolar disorder susceptibility gene.
17651942 Observational study of gene-disease association. (HuGE Navigator)
17651942 Association of polymorphism with schizophrenia not consistent with those found in other populations, and may be chance findings.
17629951 genetic associations between the DAOA gene and autism spectrum disorders
17629951 Observational study of gene-disease association. (HuGE Navigator)
17627036 Observational study of gene-disease association. (HuGE Navigator)
17627036 Data suggest that the D-amino acid oxidase activator (DAOA/G30) locus, but not D-amino acid oxidase, may play a role in the pathophysiology of schizophrenia.
17492767 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17492767 association and epistasis analyses of the DAOA/G30 and DAO loci in a sample of 373 cases with DSM-IV schizophrenia/schizoaffective disorder and 812 controls from the Republic of Ireland
17410640 Observational study of gene-disease association. (HuGE Navigator)
17408693 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17336946 Observational study of gene-disease association. (HuGE Navigator)
17293043 results support the hypothesis that variations in DAOA may play a role in schizophrenia and clinical characteristics
17250995 The genes G72 is regulate the glutamate neurotransmission in schizophrenia.
17179866 Observational study of gene-disease association. (HuGE Navigator)
17179866 These findings suggest that the G72/G30 gene may modulate the age at onset and there might be a potential interaction between this locus and sex in the pathogenesis of schizophrenia.
17179078 Meta-analysis of gene-disease association. (HuGE Navigator)
17179078 The results suggest that there is weak evidence of association between the G72/G30 genes and schizophrenia.
17055463 Observational study of gene-disease association. (HuGE Navigator)
17029202 The G72 gene polymorphism may be associated with female depressive patients without mixed family history,C allele of rs947267 may be the risk factor.
17029202 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17006672 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17006672 SNPs in RGS4, G72, GRM3, and DISC1 showed evidence for significant statistical epistasis with COMT.
16842973 Observational study of gene-disease association. (HuGE Navigator)
16791105 Observational study of gene-disease association. (HuGE Navigator)
16791105 The G72/G30 gene may be implicated in susceptibility to schizophrenia and there may be an interaction between this gene and sex in the pathogenesis of schizophrenia.
16585465 Observational study of gene-disease association. (HuGE Navigator)
16581030 Meta-analysis of gene-disease association. (HuGE Navigator)
16554747 Observational study of gene-disease association. (HuGE Navigator)
16554747 SNP variations in the G72 gene region increase risk of cognitive impairment in schizophrenia
16402132 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16402132 A statistically significant association was found between rs778293 and schizophrenia in Asian populations, but not European populations.
16263850 Observational study of gene-disease association. (HuGE Navigator)
16082701 Observational study of gene-disease association. (HuGE Navigator)
15738936 This study failed to find evidence for an association for schizophrenia with single nucleotide polymorphisms at the G72/G30 locus.
15546984 Identifies LTR class mobile element sequences at the G72/G30 locus.
15477870 Results suggest that variability of the DAOA/G30 locus may be involved in the etiology of panic disorder.
15271585 Observational study of gene-disease association. (HuGE Navigator)
15271585 the G72 region is involved in susceptibility to schizophrenia in the Ashkenazi population.
15248869 G72 gene analysis was dominated by under-transmissions. Negative transmissions involved a core haplotype complementary to the originally detected over-transmitted haplotype, suggesting the presence of a protective variant within the G72 locus.
15194506 Observational study of gene-disease association. (HuGE Navigator)
15194506 identified statistically significant differences in allele distributions of two markers rs3916965 and rs2391191, and a highly significant association between haplotype AGAC of the G72/G30 locus and schizophrenia in the Chinese population
15121480 Observational study of gene-disease association. (HuGE Navigator)
15121480 Polymorphisms in the 13q33.2 gene G72/G30 are associated with childhood-onset schizophrenia and psychosis not otherwise specified.
14966479 The association of variation at G72 with schizophrenia as well as bipolar disorder provides molecular support for the hypothesis that these two major psychiatric disorders share some of their etiologic background
12647258 data suggest that a susceptibility variant for bipolar illness exists in the vicinity of the G72/G30 genes
12364586 The association of both DAAO and a new gene G72 from 13q34 with schizophrenia together with activation of DAAO activity by a G72 protein product points to the involvement of this N-methyl-d-aspartate receptor regulation pathway in schizophrenia.

AA Sequence

MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYL      1 - 70
EMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQ     71 - 140
SCNHKEITSTKAE                                                             141 - 153
//

Text Mined References (123)

PMID Year Title
26803614 2016 Influence of DAOA and RGS4 genes on the risk for psychotic disorders and their associated executive dysfunctions: A family-based study.
26539492 2015 Identification of pLG72-Induced Oxidative Stress Using Systemic Approaches.
26170631 2015 Adaptive evolution and elucidating the potential inhibitor against schizophrenia to target DAOA (G72) isoforms.
25263995 2014 Lipidomics reveals dysfunctional glycosynapses in schizophrenia and the G72/G30 transgenic mouse.
25078755 2014 Identification of the mitochondrial MSRB2 as a binding partner of LG72.
25043320 2014 DISC1-TSNAX and DAOA genes in major depression and citalopram efficacy.
25031104 2015 Genetic variation in the G72 gene is associated with increased frontotemporal fiber tract integrity.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
24447945 2014 Association between DAOA gene polymorphisms and the risk of schizophrenia, bipolar disorder and depressive disorder.
24417347 2014 Chronic nicotine improves short-term memory selectively in a G72 mouse model of schizophrenia.
24237903 2014 The degradation (by distinct pathways) of human D-amino acid oxidase and its interacting partner pLG72--two key proteins in D-serine catabolism in the brain.
24138986 2014 Pathogenic effects of amyotrophic lateral sclerosis-linked mutation in D-amino acid oxidase are mediated by D-serine.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23861766 2013 Cognitive manic symptoms in bipolar disorder associated with polymorphisms in the DAOA and COMT genes.
23632455 2013 Effects of NRG1 and DAOA genetic variation on transition to psychosis in individuals at ultra-high risk for psychosis.
23497497 2013 Schizophrenia susceptibility and NMDA-receptor mediated signalling: an association study involving 32 tagSNPs of DAO, DAOA, PPP3CC, and DTNBP1 genes.
23495896 2013 Investigation of epistasis between DAOA and 5HTR1A variants on clinical outcomes in patients with schizophrenia.
23337943 2014 Expression of the G72/G30 gene in transgenic mice induces behavioral changes.
23335491 2013 A combined study of genetic association and brain imaging on the DAOA gene in schizophrenia.
23286827 2013 Structural, phylogenetic and docking studies of D-amino acid oxidase activator (DAOA), a candidate schizophrenia gene.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23092656 2013 Involvement of the primate specific gene G72 in schizophrenia: From genetic studies to pathomechanisms.
22884423 2012 Myelination and oxidative stress alterations in the cerebellum of the G72/G30 transgenic schizophrenia mouse model.
22851402 2012 Genotypic association of the DAOA gene with resting-state brain activity in major depression.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22454242 2012 D-amino acid oxidase activator gene (DAOA) variation affects cerebrospinal fluid homovanillic acid concentrations in healthy Caucasians.
22438288 2013 Interaction between effects of genes coding for dopamine and glutamate transmission on striatal and parahippocampal function.
22429365 2012 DAOA variants on diagnosis and response to treatment in patients with major depressive disorder and bipolar disorder.
22239582 2012 Genetic vulnerability to psychosis and cortical function: epistatic effects between DAAO and G72.
22122005 2011 DAOA variants and schizophrenia: influence on diagnosis and treatment outcomes.
21716263 2011 N-acetyl cysteine treatment rescues cognitive deficits induced by mitochondrial dysfunction in G72/G30 transgenic mice.
21679769 2011 Evidence for the interaction of D-amino acid oxidase with pLG72 in a glial cell line.
21508934 2011 Reduced cortical thickness is associated with the glutamatergic regulatory gene risk variant DAOA Arg30Lys in schizophrenia.
21443574 2011 Association between the DAOA/G72 gene and bipolar disorder and meta-analyses in bipolar disorder and schizophrenia.
21215384 2011 Interactive effects of DAOA (G72) and catechol-O-methyltransferase on neurophysiology in prefrontal cortex.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20957330 2010 Psychosis and relapse in bipolar disorder are related to GRM3, DAOA, and GRIN2B genotype.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20712760 2010 Association analysis of DAOA and DAO in bipolar disorder: results from two independent case-control studies.
20667145 2010 The DAOA/G30 locus and affective disorders: haplotype based association study in a polydiagnostic approach.
20521334 2010 Effect of ligand binding on human D-amino acid oxidase: implications for the development of new drugs for schizophrenia treatment.
20483474 2010 Testing the antagonistic pleiotropy model of schizophrenia susceptibility by analysis of DAOA, PPP1R1B, and APOL1 genes.
20471098 2010 Influence of DAOA gene variants on antipsychotic response after switch to aripiprazole.
20336655 2011 Genetic variation in G72 correlates with brain activation in the right middle temporal gyrus in a verbal fluency task in healthy individuals.
20230869 2010 Possible association of different G72/G30 SNPs with mood episodes and persecutory delusions in bipolar I Romanian patients.
20145586 2010 Association study of 20 genetic variants at the (D)-amino acid oxidase gene in schizophrenia.
20009237 2009 Genetic variation in the G720/G30 gene locus (DAOA) influences the occurrence of psychotic symptoms in patients with Alzheimer's disease.
20005295 2010 The effect of G72 genotype on neural correlates of memory encoding and retrieval.
19937977 2010 Association study of NRG1, DTNBP1, RGS4, G72/G30, and PIP5K2A with schizophrenia and symptom severity in a Hungarian sample.
19778423 2009 Effect of the G72 (DAOA) putative risk haplotype on cognitive functions in healthy subjects.
19763662 2010 DAOA/G72 predicts the progression of prodromal syndromes to first episode psychosis.
19760675 2010 G72 influences longitudinal change in frontal lobe volume in schizophrenia.
19689504 2009 Genetic variation in the G72 (DAOA) gene affects temporal lobe and amygdala structure in subjects affected by bipolar disorder.
19560517 2009 Evidence for transmission disequilibrium at the DAOA gene locus in a schizophrenia family sample.
19548263 2010 A population-based association study of candidate genes for depression and sleep disturbance.
19482054 2009 G72 gene is associated with susceptibility to methamphetamine psychosis.
19439994 2009 DTNBP1, NRG1, DAOA, DAO and GRM3 polymorphisms and schizophrenia: an association study.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19339914 2009 First evidence of association between G72 and bipolar disorder in the Chinese Han population.
19237267 2009 Association study of the G72 gene with schizophrenia in a Japanese population: a multicenter study.
19194963 2009 Common and rare variants of DAOA in bipolar disorder.
19189879 2009 Behavioral changes in G72/G30 transgenic mice.
19167508 2009 A putative high risk diplotype of the G72 gene is in healthy individuals associated with better performance in working memory functions and altered brain activity in the medial temporal lobe.
19089835 2009 G72/G30 (DAOA) and juvenile-onset mood disorders.
19077230 2008 Investigation of G72 (DAOA) expression in the human brain.
18775646 2009 Further evidence for an association of G72/G30 with schizophrenia in Chinese.
18584117 2008 Two-stage designs to identify the effects of SNP combinations on complex diseases.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18544534 2008 pLG72 modulates intracellular D-serine levels through its interaction with D-amino acid oxidase: effect on schizophrenia susceptibility.
18541412 2008 Genetic variation in the DAOA gene complex: impact on susceptibility for schizophrenia and on cognitive performance.
18516516 2008 Common risk genes for affective and schizophrenic psychoses.
18466879 2008 Association of a nonsynonymous variant of DAOA with visuospatial ability in a bipolar family sample.
18423426 2008 Genetic variation in the DAOA (G72) gene modulates hippocampal function in subjects at high risk of schizophrenia.
18346999 2008 G72 and its association with major depression and neuroticism in large population-based groups from Germany.
18198266 2008 No significant association of 14 candidate genes with schizophrenia in a large European ancestry sample: implications for psychiatric genetics.
18165970 2008 Association of DAO and G72(DAOA)/G30 genes with bipolar affective disorder.
18023149 2008 Allelic association of G72/G30 with schizophrenia and bipolar disorder: a comprehensive meta-analysis.
17880399 2007 d-Amino acid oxidase and serine racemase in human brain: normal distribution and altered expression in schizophrenia.
17767147 2007 DAOA ARG30LYS and verbal memory function in schizophrenia.
17728673 2007 No association between polymorphisms of DAO and DAOA genes and homicidal behaviors in Korean schizophrenia.
17684499 2008 Evidence implicating the candidate schizophrenia/bipolar disorder susceptibility gene G72 in mitochondrial function.
17651942 2007 Association analysis of G72/G30 polymorphisms with schizophrenia in the Korean population.
17629951 2007 Association of the DAO and DAOA gene polymorphisms with autism spectrum disorders in boys in Korea: a preliminary study.
17627036 2007 Association analyses of the DAOA/G30 and D-amino-acid oxidase genes in schizophrenia: further evidence for a role in schizophrenia.
17492767 2007 Evidence for association and epistasis at the DAOA/G30 and D-amino acid oxidase loci in an Irish schizophrenia sample.
17410640 2007 The PIP5K2A and RGS4 genes are differentially associated with deficit and non-deficit schizophrenia.
17408693 2008 Association of schizophrenia with DTNBP1 but not with DAO, DAOA, NRG1 and RGS4 nor their genetic interaction.
17336946 2007 Impact of schizophrenia candidate genes on schizotypy and cognitive endophenotypes at the population level.
17293043 2007 Association of DAOA polymorphisms with schizophrenia and clinical symptoms or therapeutic effects.
17250995 2007 Reviewing the role of the genes G72 and DAAO in glutamate neurotransmission in schizophrenia.
17179866 2006 Association of G72/G30 polymorphisms with early-onset and male schizophrenia.
17179078 2007 G72/G30 genes and schizophrenia: a systematic meta-analysis of association studies.
17152404 2006 Translational and developmental perspective on N-methyl-D-aspartate synaptic deficits in schizophrenia.
17143075 2007 The genetics of bipolar affective disorder.
17055463 2007 Significant support for DAO as a schizophrenia susceptibility locus: examination of five genes putatively associated with schizophrenia.
17029202 2006 [Association between depression and G72 gene polymorphism].
17006672 2007 Evidence for statistical epistasis between catechol-O-methyltransferase (COMT) and polymorphisms in RGS4, G72 (DAOA), GRM3, and DISC1: influence on risk of schizophrenia.
16842973 2006 No association of G72 and D-amino acid oxidase genes with schizophrenia.
16791105 2006 Family-based association study between G72/G30 genetic polymorphism and schizophrenia.
16603472 Carving chaos: genetics and the classification of mood and psychotic syndromes.
16585465 2006 Variation at the DAOA/G30 locus influences susceptibility to major mood episodes but not psychosis in schizophrenia and bipolar disorder.
16581030 2006 G72/G30 in schizophrenia and bipolar disorder: review and meta-analysis.
16554747 2006 The G72/G30 gene complex and cognitive abnormalities in schizophrenia.
16402132 2006 Further evidence for the association between G72/G30 genes and schizophrenia in two ethnically distinct populations.
16263850 2005 Genotype-phenotype studies in bipolar disorder showing association between the DAOA/G30 locus and persecutory delusions: a first step toward a molecular genetic classification of psychiatric phenotypes.
16183301 2006 Expression in Escherichia coli and in vitro refolding of the human protein pLG72.
16082701 2006 Transmission disequilibrium and haplotype analyses of the G72/G30 locus: suggestive linkage to schizophrenia in Palestinian Arabs living in the North of Israel.
16009449 2005 Schizophrenia: genes at last?
15738936 2005 Evidence for linkage to chromosome 13q32 in an independent sample of schizophrenia families.
15546984 2004 Coding sequences of functioning human genes derived entirely from mobile element sequences.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15477870 2005 Investigation of the DAOA/G30 locus in panic disorder.
15271585 2004 Is the G72/G30 locus associated with schizophrenia? single nucleotide polymorphisms, haplotypes, and gene expression analysis.
15248869 2004 The contribution of three strong candidate schizophrenia susceptibility genes in demographically distinct populations.
15194506 2004 Association of G72/G30 with schizophrenia in the Chinese population.
15121480 2004 Polymorphisms in the 13q33.2 gene G72/G30 are associated with childhood-onset schizophrenia and psychosis not otherwise specified.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14966479 2004 Examination of G72 and D-amino-acid oxidase as genetic risk factors for schizophrenia and bipolar affective disorder.
14759258 2004 An unappreciated role for RNA surveillance.
12647258 2003 Polymorphisms at the G72/G30 gene locus, on 13q33, are associated with bipolar disorder in two independent pedigree series.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364586 2002 Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia.
11181995 2001 The sequence of the human genome.