Property Summary

Ligand Count 125
NCBI Gene PubMed Count 80
PubMed Score 262.48
PubTator Score 447.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 1.1e-02
posterior fossa group A ependymoma 1.300 2.2e-02
subependymal giant cell astrocytoma -2.157 3.2e-02

Protein-protein Interaction (2)

PDB (17)

Gene RIF (74)

AA Sequence

MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQ      1 - 70
TFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILE     71 - 140
GKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM    141 - 210
KHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT    211 - 280
GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL       281 - 347
//

Text Mined References (83)

PMID Year Title