Property Summary

NCBI Gene PubMed Count 76
PubMed Score 256.43
PubTator Score 447.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 1.1e-02
posterior fossa group B ependymoma 2.600 1.1e-05
subependymal giant cell astrocytoma -2.157 3.2e-02

Synonym

Accession P14920 B2R7I5 Q16758 Q8N6R2 DAAO
Symbols DAAO
OXDA
DAMOX

Gene

DAO

PDB

2DU8   2E48   2E49   2E4A   2E82   2GNZ   3CUK   3G3E   3W4I   3W4J   3W4K   3ZNN   3ZNO   3ZNP   3ZNQ   4QFC   4QFD  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (70)

PMID Text
26986737 The DAO gene was a susceptibility gene for schizophrenia and the genomic region between intron 1 and intron 8 may harbor functional genetic variants, which may influence the mRNA expression of DAO and neurocognitive functions in schizophrenia.
25982580 lower levels predispose to disease exacerbation after fish intake in chronic urticaria patients
24256253 In the brain, the concentration of D-serine stored in cells is defined by the activity of D-amino acid oxidase.
24237903 Data suggest that neuronal DAAO is a long-lived protein: peroxisomal fraction of DAAO is degraded via lysosomal/endosomal pathway, whereas cytosolic fraction of DAAO is ubiquitinated and targeted to proteasome pathway.
24085347 Accumulation of d-serine contributes to an ALS pathogenesis, and DAO might be a common therapeutic target for ALS.
23859606 Data suggest that acyclovir (ACV) can serve as an active site probe to study the structural basis of temperature-induced conformational changes of d-Amino acid oxidase (DAO).
23555897 The results suggest that DAO, which is involved in the N-methyl-d-aspartate receptor regulation, signaling and glutamate metabolism, is the master gene of the genetic associations and interactions underlying schizophrenia.
23497497 study suggests that NMDA receptor-mediated signalling genes, DAO, PPP3CC, DTNBP1 might be involved in schizophrenia pathogenic mechanisms related to gender
23219954 Data indicate that the protein aggregation due to the expression of the G331V d-amino acid oxidase (hDAAO) variant affects cell viability.
23152756 The DAO polymorphism rs10156191 which causes impaired metabolism of circulating histamine is associated with the clinical response in crossed-hypersensitivity to NSAIDs and could be used as a biomarker of response.
22865246 The distribution pattern of D-amino-acid oxidase gene and protein expression in the central nervous system is inversely correlated with D-serine content and distribution. (Review)
22802136 D-Amino acid oxidase-induced oxidative stress, 3-bromopyruvate and citrate inhibit angiogenesis, exhibiting potent anticancer effects.
22239582 A significant 3 way interaction between G72, DAAO and diagnosis is detected in the right middle temporal gyrus (after family-wise error correction), accounting for 8.5% of the individual variance in activation.
21700703 D-amino acid oxidase activity is inhibited by an interaction with bassoon protein at the presynaptic active zone.
21679769 Data suggest that newly synthesized D-amino acid oxidase colocalizes and interacts with pLG72 which appears to be exposed on the external membrane of mitochondria.
21471957 Genetic polymorphisms in DAO are associated with reduced prepulse inhibition and worse performance in working memory tasks and a personality pattern characterized by attenuated anxiety.
21421061 results suggest that genetic variation in DAAO has a significant impact on both regional activation and functional connectivity
20855273 The rs3918347 allele nucleotide polymorphism of DAAO is associated with schizophrenia in Chinese.
20855273 Observational study of gene-disease association. (HuGE Navigator)
20712760 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20521334 Data describe the the effects on human D-amino acid oxidase conformation and stability of the substrate D-serine, the FAD cofactor, and two inhibitors (benzoate and chlorpromazine.
20483168 This study supported the hypothesis that DAO plays a role in schizophrenia, possibly in a gender-dependent manner in Koreans.
20483168 Observational study of gene-disease association. (HuGE Navigator)
20368421 Familial amyotrophic lateral sclerosis is associated with a mutation in D-amino acid oxidase
20178891 The results of this study showed that DAO does not have an apparent degree of association with Japanese schizophrenia.
20178891 Observational study of gene-disease association. (HuGE Navigator)
19823762 increased hippocampal DAAO expression in schizophrenia; could be responsible for a decrease in local D-serine levels leading to a NMDA-receptor hypofunction that is hypothesized to play a major role in the pathophysiology of schizophrenia
19729970 The present association of dysbindin SNPs with negative symptoms and DAO SNPs with anxiety and depression is a replication of earlier findings and strengthens the hypothesis of a genetic association in schizophrenia.
19729970 Observational study of gene-disease association. (HuGE Navigator)
19693267 Observational study of gene-disease association. (HuGE Navigator)
19685198 results suggest that an increase in DAO expression in parts of the brain is involved in aberrant D-amino acid metabolism, may be a potential therapeutic target for schizophrenia
19670078 Observational study of gene-disease association. (HuGE Navigator)
19586533 Observational study of gene-disease association. (HuGE Navigator)
19439994 present Scandinavian results do not verify previous associations between the analyzed DTNBP1, NRG1, DAO, DAOA, and GRM3 gene polymorphisms and schizophrenia
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19309736 Flavin-Adenine Dinucleotide binding only slightly increases the stability of human DAAO to denaturation by urea or temperature.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19223009 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18715757 Meta-analysis of gene-disease association. (HuGE Navigator)
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18560437 DAO activity and expression are increased in schizophrenia, but are not related to DAO or G72/G30 genotype
18544534 a decrease in the synaptic concentration of d-serine as the result of an anomalous increase in hDAAO activity related to hypoexpression of pLG72 may represent a molecular mechanism by which hDAAO and pLG72 are involved in schizophrenia susceptibility
18165970 Some support for the individual involvement of DAO and G72(DAOA)/G30 in the etiology of bipolar disorder.
18165970 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17890006 Observational study of gene-disease association. (HuGE Navigator)
17890006 These data suggest a potential role for DAO in susceptibility to depressive symptoms in schizophrenia, but a more general role for DAO in affective disorders cannot be excluded.
17728673 Polymorphisms are not associated with homicidal behavior in korean schizophrenics.
17629951 significant associations between the rs3918346 and rs3825251 SNPs of the DAO gene and boys with autism spectrum disorders
17629951 Observational study of gene-disease association. (HuGE Navigator)
17627036 Observational study of gene-disease association. (HuGE Navigator)
17627036 Data suggest that the D-amino acid oxidase activator (DAOA/G30) locus, but not D-amino acid oxidase, may play a role in the pathophysiology of schizophrenia.
17492767 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17492767 evidence for epistatic interaction between the associated SNPs at DAOActivator and D-amino acid oxidase genes in contributing to schizophrenia risk
17408693 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17336946 Observational study of gene-disease association. (HuGE Navigator)
17336946 might exert gene-specific modulating effects on schizophrenia endophenotypes at the population level
17250995 The genes D-Amino-Acid Oxidase is regulate the glutamate neurotransmission in schizophrenia.
17179078 Meta-analysis of gene-disease association. (HuGE Navigator)
17088322 Crystal structure of human D-amino acid oxidase.
17055463 Observational study of gene-disease association. (HuGE Navigator)
16828464 We found elevated cerebellar DAAO activities in post-mortem brain samples from schizophrenic versus normal individuals.
16616139 the human enzyme is a stable homodimer even in the apoprotein form and weakly binds the cofactor in the free form.
16380905 Observational study of gene-disease association. (HuGE Navigator)
15464270 Observational study of gene-disease association. (HuGE Navigator)
15464270 This study indicates that the DAAO gene may play a significant role in the etiology of schizophrenia in the Han Chinese.
14966479 DAAO was associated with schizophrenia, but not with bipolar disorder
12364586 The association of both DAAO and a new gene G72 from 13q34 with schizophrenia together with activation of DAAO activity by a G72 protein product points to the involvement of this N-methyl-d-aspartate receptor regulation pathway in schizophrenia.
12053066 Creatinine (CTN) was found to inhibit D-amino acid oxidase in uremia

AA Sequence

MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQ      1 - 70
TFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILE     71 - 140
GKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM    141 - 210
KHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT    211 - 280
GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL       281 - 347
//

Text Mined References (79)

PMID Year Title
26986737 2016 Haplotypes of the D-Amino Acid Oxidase Gene Are Significantly Associated with Schizophrenia and Its Neurocognitive Deficits.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25982580 Diamine oxidase levels in different chronic urticaria phenotypes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256253 2013 D-Serine metabolism: new insights into the modulation of D-amino acid oxidase activity.
24237903 2014 The degradation (by distinct pathways) of human D-amino acid oxidase and its interacting partner pLG72--two key proteins in D-serine catabolism in the brain.
24085347 2013 Amyotrophic lateral sclerosis: an update on recent genetic insights.
23859606 2013 The antiviral drug acyclovir is a slow-binding inhibitor of (D)-amino acid oxidase.
23555897 2013 The DAO gene is associated with schizophrenia and interacts with other genes in the Taiwan Han Chinese population.
23497497 2013 Schizophrenia susceptibility and NMDA-receptor mediated signalling: an association study involving 32 tagSNPs of DAO, DAOA, PPP3CC, and DTNBP1 genes.
23219954 2013 Characterization of human DAAO variants potentially related to an increased risk of schizophrenia.
23152756 2012 The diamine oxidase gene is associated with hypersensitivity response to non-steroidal anti-inflammatory drugs.
22865246 2012 Structure-function relationships in human D-amino acid oxidase.
22802136 2012 D-Amino acid oxidase-induced oxidative stress, 3-bromopyruvate and citrate inhibit angiogenesis, exhibiting potent anticancer effects.
22239582 2012 Genetic vulnerability to psychosis and cortical function: epistatic effects between DAAO and G72.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21700703 2011 D-amino acid oxidase activity is inhibited by an interaction with bassoon protein at the presynaptic active zone.
21679769 2011 Evidence for the interaction of D-amino acid oxidase with pLG72 in a glial cell line.
21471957 2011 The association of schizophrenia risk D-amino acid oxidase polymorphisms with sensorimotor gating, working memory and personality in healthy males.
21421061 2011 Differential effects of DAAO on regional activation and functional connectivity in schizophrenia, bipolar disorder and controls.
20855273 2010 [Correlation of D-amino acid-oxidase gene polymorphism to schizophrenia].
20712760 2010 Association analysis of DAOA and DAO in bipolar disorder: results from two independent case-control studies.
20603179 2010 Thiolactomycin inhibits D-aspartate oxidase: a novel approach to probing the active site environment.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20521334 2010 Effect of ligand binding on human D-amino acid oxidase: implications for the development of new drugs for schizophrenia treatment.
20483168 2010 Sex-different association of DAO with schizophrenia in Koreans.
20368421 2010 Familial amyotrophic lateral sclerosis is associated with a mutation in D-amino acid oxidase.
20178891 2010 No association between DAO and schizophrenia in a Japanese patient population: a multicenter replication study.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19823762 2009 Increased D-amino acid oxidase expression in the bilateral hippocampal CA4 of schizophrenic patients: a post-mortem study.
19729970 2009 Dysbindin and d-amino-acid-oxidase gene polymorphisms associated with positive and negative symptoms in schizophrenia.
19693267 2009 Financial and psychological risk attitudes associated with two single nucleotide polymorphisms in the nicotine receptor (CHRNA4) gene.
19685198 2009 Potential pathophysiological role of D-amino acid oxidase in schizophrenia: immunohistochemical and in situ hybridization study of the expression in human and rat brain.
19670078 2009 Analysis of a non-synonymous single nucleotide polymorphism of the human diamine oxidase gene (ref. SNP ID: rs1049793) in patients with Crohn's disease.
19586533 2009 Evidence for the association of the DAOA (G72) gene with schizophrenia and bipolar disorder but not for the association of the DAO gene with schizophrenia.
19439994 2009 DTNBP1, NRG1, DAOA, DAO and GRM3 polymorphisms and schizophrenia: an association study.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19309736 2009 Relevance of weak flavin binding in human D-amino acid oxidase.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19223009 2009 Association analysis of glycine- and serine-related genes in a Japanese population of patients with schizophrenia.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
18715757 2008 Genetic associations with schizophrenia: meta-analyses of 12 candidate genes.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18560437 2008 D-amino acid oxidase activity and expression are increased in schizophrenia.
18544534 2008 pLG72 modulates intracellular D-serine levels through its interaction with D-amino acid oxidase: effect on schizophrenia susceptibility.
18455394 2008 The discovery of fused pyrrole carboxylic acids as novel, potent D-amino acid oxidase (DAO) inhibitors.
18165970 2008 Association of DAO and G72(DAOA)/G30 genes with bipolar affective disorder.
17890006 2007 D-amino acid oxidase (DAO) genotype and mood symptomatology in schizophrenia.
17728673 2007 No association between polymorphisms of DAO and DAOA genes and homicidal behaviors in Korean schizophrenia.
17629951 2007 Association of the DAO and DAOA gene polymorphisms with autism spectrum disorders in boys in Korea: a preliminary study.
17627036 2007 Association analyses of the DAOA/G30 and D-amino-acid oxidase genes in schizophrenia: further evidence for a role in schizophrenia.
17492767 2007 Evidence for association and epistasis at the DAOA/G30 and D-amino acid oxidase loci in an Irish schizophrenia sample.
17408693 2008 Association of schizophrenia with DTNBP1 but not with DAO, DAOA, NRG1 and RGS4 nor their genetic interaction.
17336946 2007 Impact of schizophrenia candidate genes on schizotypy and cognitive endophenotypes at the population level.
17303072 2007 Structural basis of D-DOPA oxidation by D-amino acid oxidase: alternative pathway for dopamine biosynthesis.
17250995 2007 Reviewing the role of the genes G72 and DAAO in glutamate neurotransmission in schizophrenia.
17179078 2007 G72/G30 genes and schizophrenia: a systematic meta-analysis of association studies.
17088322 2006 Crystal structure of human D-amino acid oxidase: context-dependent variability of the backbone conformation of the VAAGL hydrophobic stretch located at the si-face of the flavin ring.
17055463 2007 Significant support for DAO as a schizophrenia susceptibility locus: examination of five genes putatively associated with schizophrenia.
16828464 2006 Preliminary evidence for a link between schizophrenia and NMDA-glycine site receptor ligand metabolic enzymes, d-amino acid oxidase (DAAO) and kynurenine aminotransferase-1 (KAT-1).
16616139 2006 Characterization of human D-amino acid oxidase.
16380905 2005 Bipolar I disorder and schizophrenia: a 440-single-nucleotide polymorphism screen of 64 candidate genes among Ashkenazi Jewish case-parent trios.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15956068 2005 Primary hyperoxaluria: from gene defects to designer drugs?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15464270 2004 Association of DAAO with schizophrenia in the Chinese population.
14966479 2004 Examination of G72 and D-amino-acid oxidase as genetic risk factors for schizophrenia and bipolar affective disorder.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12364586 2002 Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia.
12053066 2002 Creatinine inhibits D-amino acid oxidase.
11452983 2001 Assignment of D-amino-acid oxidase gene to a human and a mouse chromosome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8195119 1994 An environmentally regulated receptor for diamine oxidase modulates human endothelial cell/fibroblast histamine degradative uptake.
8182053 1994 The human gene for diamine oxidase, an amiloride binding protein. Molecular cloning, sequencing, and characterization of the promoter.
2901986 1988 Molecular cloning and sequence analysis of cDNA encoding human kidney D-amino acid oxidase.
2885296 1987 Immunoelectron microscopic localization of D-amino acid oxidase in rat kidney and liver.
1356107 1992 Molecular cloning and chromosomal localization of a human gene encoding D-amino-acid oxidase.