Property Summary

Ligand Count 9
NCBI Gene PubMed Count 12
PubMed Score 14.47
PubTator Score 4.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Obesity 678
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cannabis dependence 23 4.327 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
aldosterone-producing adenoma -1.060 2.2e-02
gastric carcinoma 1.300 3.8e-02
medulloblastoma, large-cell -1.100 7.7e-06
osteosarcoma -1.878 1.4e-04
primary pancreatic ductal adenocarcinoma 1.165 3.9e-03

Gene RIF (3)

AA Sequence

MPGMVLFGRRWAIASDDLVFPGFFELVVRVLWWIGILTLYLMHRGKLDCAGGALLSSYLIVLMILLAVVI      1 - 70
CTVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAWVADGVQCDRTVVNGIIATVVVS     71 - 140
WIIIAATVVSIIIVFDPLGGKMAPYSSAGPSHLDSHDSSQLLNGLKTAATSVWETRIKLLCCCIGKDDHT    141 - 210
RVAFSSTAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGSSQEADLDAELENCHH    211 - 280
YMQFAAAAYGWPLYIYRNPLTGLCRIGGDCCRSRTTDYDLVGGDQLNCHFGSILHTTGLQYRDFIHVSFH    281 - 350
DKVYELPFLVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGISQAARYVYQRLI    351 - 420
NDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRGLWSKALQEYSQSFIVSL    421 - 490
VLGKDVIPRLSVTNLEDLKRRILRVVAHCNKPKYKILLHGLWYELFGGNPNNLPTELDGGDQEVLTQPLL    491 - 560
GEQSLLTRWSPAYSFSSDSPLDSSPKYPPLYPPGRIIHLQEEGASGRFGCCSAAHYSAKWSHEAEFSKIL    561 - 630
IGPKMLTDHMPDILMRALDSVVSDRAACVSCPAQGVSSVDVA                                631 - 672
//

Text Mined References (20)

PMID Year Title