Property Summary

NCBI Gene PubMed Count 22
PubMed Score 357.93
PubTator Score 57.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.592 4.6e-03
Multiple myeloma 2.208 1.6e-04
glioblastoma 1.200 2.6e-03
lung cancer 1.900 2.9e-03
diabetes mellitus -1.200 1.9e-03
acute myeloid leukemia -1.500 4.3e-02
ovarian cancer 3.200 2.2e-05

Protein-protein Interaction (7)

Gene RIF (7)

PMID Text
21606320 single-nucleotide polymorphisms in DAD1 gene is associated with neuroendocrine tumor.
21509594 DAD1 gene expression is decreased in follicular variant of papillary thyroid carcinoma.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of defender against cell death 1 (DAD1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18383209 DAD1 protein overexpression is associated with small bowel carcinoid tumors

AA Sequence

MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILA      1 - 70
VCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG                                71 - 113
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21606320 2011 Genetic associations with sporadic neuroendocrine tumor risk.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
18383209 2008 High-resolution analysis of genetic alterations in small bowel carcinoid tumors reveals areas of recurrent amplification and loss.
15835887 2005 Proteomic analysis of mammalian oligosaccharyltransferase reveals multiple subcomplexes that contain Sec61, TRAP, and two potential new subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10965038 2000 A subunit of the mammalian oligosaccharyltransferase, DAD1, interacts with Mcl-1, one of the bcl-2 protein family.
10384128 1999 Enhancer-blocking activity within the DNase I hypersensitive site 2 to 6 region between the TCR alpha and Dad1 genes.
9167970 1997 The highly conserved DAD1 protein involved in apoptosis is required for N-linked glycosylation.
9144178 1997 DAD1, the defender against apoptotic cell death, is a subunit of the mammalian oligosaccharyltransferase.
8413235 1993 Molecular cloning of a human cDNA encoding a novel protein, DAD1, whose defect causes apoptotic cell death in hamster BHK21 cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7737422 1995 The highly conserved defender against the death 1 (DAD1) gene maps to human chromosome 14q11-q12 and mouse chromosome 14 and has plant and nematode homologs.
7601483 1995 The DAD1 protein, whose defect causes apoptotic cell death, maps to human chromosome 14.