Property Summary

NCBI Gene PubMed Count 27
PubMed Score 75.14
PubTator Score 39.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.500 1.9e-02
ependymoma -1.900 1.8e-02
oligodendroglioma -1.300 2.9e-02
psoriasis -1.600 2.2e-03
sonic hedgehog group medulloblastoma 1.300 2.8e-02
atypical teratoid / rhabdoid tumor -1.600 6.3e-03
glioblastoma -1.400 1.2e-02
tuberculosis and treatment for 6 months 1.300 3.0e-04
primary pancreatic ductal adenocarcinoma 2.378 2.1e-03
X-linked cerebral adrenoleukodystrophy 4.100 9.5e-03
lung cancer 5.400 7.8e-07
active Crohn's disease 2.533 1.2e-03
active ulcerative colitis 1.332 3.9e-03
subependymal giant cell astrocytoma -3.485 1.2e-03
ovarian cancer 2.400 8.9e-05
pancreatic cancer 2.100 2.1e-03

Gene RIF (20)

PMID Text
26099026 Dact1 has a critical role in the ability support keratinocyte proliferation, by attenuating Wnt/beta catenin signaling.
25825496 Dpr1 promotes the ubiquitination of Dvl2 by pVHL and mediates the protein aggregate-elicited autophagy initiation
25558878 Overexpression of Dapper-1 allows the translocation of MIZ-1 from the nucleus to the cytoplasm.
25524937 There was no statistical difference between groups concerning DACT1 and DACT2 either in promoter hypermethylation or transcript levels. Age was associated with DACT2 promoter hypermethylation, especially over 56 years old.
25424899 our results suggested that DACT1 was upregulated during human placenta development.
24980960 Dpr1 directly interacts with Beclin1 and Atg14L and enhances the Beclin1-Vps34 interaction and Vps34 activity.
23696638 Data indicate that Sestd1 cooperates with Dact1 in Vangl2 regulation and in the planar cell polarity (PCP) pathway during mammalian embryonic development.
23073659 These findings provided insight into the role of DACT1 as a novel functional tumor suppressor in gastric cancer through inhibiting NF-kappaB signaling pathway.
22610794 five missense heterozygote mutations of the DACT1 gene are specifically identified in 167 stillborn or miscarried Han Chinese fetuses with neural tube defects.
22470507 DACT1 stabilizes beta-catenin via DACT1-induced effects on GSK-3beta and directly interacts with beta-catenin proteins.
21525190 Cytoplasmic HDPR1 protein expression was associated with tumor malignant progression via beta-catenin accumulation.
21262972 14-3-3beta interacts with human Dapper1, attenuating the ability of hDpr1 to promote Dishevelled (Dvl) degradation, thus enhancing Wnt signaling
21176356 As(2)O(3) induces demethylation of hdpr1 gene from abnormal hypermethylation status and activates its reexpression, thus suppressing the proliferation of Jurkat cells.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20232357 Knockdown of HDPR1 gene enhanced the invasive ability of lung cancer cells, which was dependent on p120ctn and independent of beta-catenin
19733838 Observational study of gene-disease association. (HuGE Navigator)
19073771 Dact1 regulates adipogenesis through coordinated effects on gene expression that selectively alter intracellular and paracrine/autocrine components of the Wnt/beta-catenin signaling pathway.
18936100 Dpr1 negatively modulates the basal activity of Wnt1/beta-catenin signaling in the nucleus by keeping LEF1 in the repressive state.
16446366 DACT1 antagonizes Wnt signaling by promoting DVL2 degradation.
15580286 Downregulation of HDPR1 is common in hepatic cellular carcinomas, frequently involves hypermethylation of the promoter region.

AA Sequence

MKPSPAGTAKELEPPAPARGEQRTAEPEGRWREKGEADTERQRTRERQEATLAGLAELEYLRQRQELLVR      1 - 70
GALRGAGGAGAAAPRAGELLGEAAQRSRLEEKFLEENILLLRKQLNCLRRRDAGLLNQLQELDKQISDLR     71 - 140
LDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCHSSTCFCSPLEATLSLSDGCPKS    141 - 210
ADLIGLLEYKEGHCEDQASGAVCRSLSTPQFNSLDVIADVNPKYQCDLVSKNGNDVYRYPSPLHAVAVQS    211 - 280
PMFLLCLTGNPLREEDRLGNHASDICGGSELDAVKTDSSLPSPSSLWSASHPSSSKKMDGYILSLVQKKT    281 - 350
HPVRTNKPRTSVNADPTKGLLRNGSVCVRAPGGVSQGNSVNLKNSKQACLPSGGIPSLNNGTFSPPKQWS    351 - 420
KESKAEQAESKRVPLPEGCPSGAASDLQSKHLPKTAKPASQEHARCSAIGTGESPKESAQLSGASPKESP    421 - 490
SRGPAPPQENKVVQPLKKMSQKNSLQGVPPATPPLLSTAFPVEERPALDFKSEGSSQSLEEAHLVKAQFI    491 - 560
PGQQPSVRLHRGHRNMGVVKNSSLKHRGPALQGLENGLPTVREKTRAGSKKCRFPDDLDTNKKLKKASSK    561 - 630
GRKSGGGPEAGVPGRPAGGGHRAGSRAHGHGREAVVAKPKHKRTDYRRWKSSAEISYEEALRRARRGRRE    631 - 700
NVGLYPAPVPLPYASPYAYVASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGEFVGES    701 - 770
TTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV        771 - 836
//

Text Mined References (29)

PMID Year Title
26099026 2015 Dact1 Regulates the Ability of 3T3-J2 Cells to Support Proliferation of Human Epidermal Keratinocytes.
25825496 2015 The Wnt Signaling Antagonist Dapper1 Accelerates Dishevelled2 Degradation via Promoting Its Ubiquitination and Aggregate-induced Autophagy.
25558878 2015 Myc-interacting zinc-finger protein 1 positively regulates Wnt signalling by protecting Dishevelled from Dapper1-mediated degradation.
25524937 2015 Expression and epigenetic regulation of DACT1 and DACT2 in oral squamous cell carcinoma.
25424899 2015 DACT1 is involved in human placenta development by promoting Wnt signaling.
24980960 2014 Dapper1 promotes autophagy by enhancing the Beclin1-Vps34-Atg14L complex formation.
23696638 2013 SEC14 and spectrin domains 1 (Sestd1) and Dapper antagonist of catenin 1 (Dact1) scaffold proteins cooperatively regulate the Van Gogh-like 2 (Vangl2) four-pass transmembrane protein and planar cell polarity (PCP) pathway during embryonic development in mice.
23073659 2012 Dapper homolog 1 is a novel tumor suppressor in gastric cancer through inhibiting the nuclear factor-?B signaling pathway.
22610794 2012 Identification of novel rare mutations of DACT1 in human neural tube defects.
22470507 2012 Oncogenic function of DACT1 in colon cancer through the regulation of ?-catenin.
21718540 2011 All Dact (Dapper/Frodo) scaffold proteins dimerize and exhibit conserved interactions with Vangl, Dvl, and serine/threonine kinases.
21525190 2011 Cytoplasmic HDPR1 is involved in regional lymph node metastasis and tumor development via beta-catenin accumulation in esophageal squamous cell carcinoma.
21262972 2011 Protein kinase A-mediated 14-3-3 association impedes human Dapper1 to promote dishevelled degradation.
21176356 2010 [Mechanism of As(2)O(3) on hdpr1 gene demethylation in Jurkat cell line].
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20232357 2010 Downregulation of HDPR1 is associated with poor prognosis and affects expression levels of p120-catenin and beta-catenin in nonsmall cell lung cancer.
19733838 2009 Case-control study of six genes asymmetrically expressed in the two cerebral hemispheres: association of BAIAP2 with attention-deficit/hyperactivity disorder.
19073771 2009 Dact1, a nutritionally regulated preadipocyte gene, controls adipogenesis by coordinating the Wnt/beta-catenin signaling network.
18936100 2008 Dapper1 is a nucleocytoplasmic shuttling protein that negatively modulates Wnt signaling in the nucleus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17197390 2007 The evolutionally conserved activity of Dapper2 in antagonizing TGF-beta signaling.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16446366 2006 Dapper 1 antagonizes Wnt signaling by promoting dishevelled degradation.
15580286 2005 HDPR1, a novel inhibitor of the WNT/beta-catenin signaling, is frequently downregulated in hepatocellular carcinoma: involvement of methylation-mediated gene silencing.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12632086 2003 Identification and characterization of human DAPPER1 and DAPPER2 genes in silico.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11970895 2002 Dapper, a Dishevelled-associated antagonist of beta-catenin and JNK signaling, is required for notochord formation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.