Property Summary

NCBI Gene PubMed Count 67
PubMed Score 303.49
PubTator Score 47.23

Knowledge Summary

Patent

No data available

Pathway (1)

Protein-protein Interaction (1)

Gene RIF (39)

PMID Text
25940701 DACH1 expression was reduced in hepatocellular carcinoma even at early stage and associated with tumor progression. Overexpression inhibited HCC cell growth and migration by inactivating the Wnt pathway via GSK3beta phosphorylation to suppress beta-catenin.
25788272 Kaplan-Mier analysis of human NSCLC samples demonstrated that high DACH1 mRNA levels predicted favorable prognosis for relapse-free and overall survival. In agreement, high CXCL5 expression predicted a worse prognosis for survival.
25778865 results suggest that DACH1 loss of function results in increased cell growth, motility and invasiveness through TGF-beta-mediated EMT, and DACH1 loss of function has important therapeutic implications for targeted therapies of CRC
25776071 DACH1 inhibits aldosterone secretion in human adrenals, and transforming growth factor-beta signaling pathway is activated in DACH1 overexpressed cells and may mediate inhibition of aldosterone secretion in human adrenals.
25769723 DACH1 is a determinant of benign and malignant prostate epithelium cellular growth, migration, and cytokine abundance in vivo.
25487617 Further evaluation of the methylation of DACH1, DKK1, and WIF1 in a clinical patient group confirmed the frequent methylation of WIF1 and intermediate or low frequency of methylation of DACH1 or DKK1, respectively.
25410484 In breast cancer, some GATA3 effects shift from tumor suppressing to tumor promoting during tumorigenesis, with deregulation of three genes, BCL2, DACH1, THSD4, representing major GATA3-controlled processes in cancer progression.
25322986 Results indicated that DACH1 was a novel molecular marker of RCC and it attributed to the malignant behavior of renal cancer cells.
24912879 Data indicate that dachshund family transcription factor 1 (DACH1) suppresses gastric cancer cell proliferation, invasion and metastasis by inhibiting transforming growth factor beta (TGF-beta) signalling pathways both in vitro and in vivo.
24465431 Familial young-onset diabetes, pre-diabetes and cardiovascular disease are associated with genetic variants of DACH1 in Chinese
24392136 Nuclear DACH1 expression appears to be a Luminal A biomarker predictive of good prognosis, but is not independent of clinical stage, tumour size, NPI status or systemic therapy.
24335958 Cell fate factor DACH1 represses YB-1-mediated oncogenic transcription and translation.
24149323 DACH1 is frequently methylated in human colorectal cancers (CRC) and methylation of DACH1 may serve as detective and prognostic marker in CRC.
23492369 DACH1 binds p53 to inhibit NSCLC cellular growth.
22902925 the inability of C/EBPalpha and GATA-1 to down-regulate DACH1 expression induced by MLL-AF9 during myeloid differentiation may contribute to t(9;11) leukemogenesis.
22781112 DACH1 gene promoter methylation could lead to a decrease or absence of DACH1 expression in endometrial carcinoma.
22405764 The knockdown of DACH1 blocked the cell cycle progression of HL-60 promyeloblastic cells through the decrease of cyclin D1, D3, F, and Cdk 1, 4, and 6 and increase in p21(Cip1), which in turn decreased the phosphorylation of the Rb protein.
22367319 DACH1 is highly expressed in metastatic ovarian cancer compared with that of normal, benign, and borderline ovarian tissues and could play an important role in cancer growth.
21750150 DACH1 is a distinctive tumor suppressor, which not only suppresses growth of tumor cells but also regulates bFGF-mediated tumor-initiating activity of glioma cells
21558809 in cells growing in IGF-1 (and unresponsive to EGF), DACH1 is devoid of tumor suppressor activity.
20956529 DACH1 represses gene transcription through direct DNA binding to the promoter region of target genes by recruiting the transcriptional co-regulator, TCERG1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351289 Forkhead signaling is attenuated by the retinal determination factor DACH1
19913121 Observational study of gene-disease association. (HuGE Navigator)
19901965 Findings identify a role of EYA4 and possibly interacting SIX and DACH proteins in MPNSTs and suggest the EYA4 pathway as a rational therapeutic target.
19605405 Data show that DACH1 expression, which is lost in poor prognosis human breast cancer, functions as an endogenous inhibitor of ERalpha function.
19502783 The altered expression of human DACH1 has been associated with tumor progression and metastasis. DACH1 inhibits breast cancer cellular proliferation via cyclin D1.
19351840 DACH1 inhibited ligand-dependent activity of AR mutations identified in patients with androgen-insensitive prostate cancer. The DS domain was sufficient for repression of the AR wild-type but failed to repress an AR acetylation site point mutant.
18957060 a statistical significance level for DACH1 in gastric cancer
18639284 DACH1 is hypermethylated in renal cell carcinoma.
18467491 These data identify a pathway by which an endogenous cell-fate determination factor blocks oncogene-dependent tumor metastasis via a key heterotypic mediator.
17891780 DACH1 plays an important role in negative regulation of RANKL gene expression in marrow stromal/preosteoblast cells in the bone microenvironment.
16980615 DACH1 repressed cyclin D1 through a novel mechanism via a c-Jun DNA-binding partner, requiring the DACH1 alpha-helical DS domain which recruits corepressors to the local chromatin.
15818552 The dachshund is required in mushroom body neurons for proper axon guidance and branching in Drosophila melanogaster.
14563999 identifed DACH enhancers in gene deserts
14525983 DACH1 bound to endogenous NCoR and Smad4 in cultured cells; Smad4 was required for DACH1 repression of TGF-beta induction of Smad signaling
12057194 forms an alpha/beta structure containing a DNA binding motif similar

AA Sequence

MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPIASAAAAAATV      1 - 70
TSTGGGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGGGISAGGGVASSTPINAST     71 - 140
GSSSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCEL    141 - 210
ICLPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYND    211 - 280
CTNASSRPGRPPKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIK    281 - 350
LEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNH    351 - 420
LQQSHLLPNGLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQVQSPPSRVETSVIKERV    421 - 490
PDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQMLMGLSPNVLPGPKEGD    491 - 560
LAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFPDGLSSIETLLTNIQGL    561 - 630
LKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKKAKRKLQEALEF    631 - 700
ETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQDGRLYLKTTVMY              701 - 760
//

Text Mined References (66)

PMID Year Title
25940701 2015 DACH1 is a novel predictive and prognostic biomarker in hepatocellular carcinoma as a negative regulator of Wnt/?-catenin signaling.
25788272 2015 DACH1 inhibits lung adenocarcinoma invasion and tumor growth by repressing CXCL5 signaling.
25778865 2015 Suppression of DACH1 promotes migration and invasion of colorectal cancer via activating TGF-?-mediated epithelial-mesenchymal transition.
25776071 2015 DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-? signaling and suppresses aldosterone secretion.
25769723 2015 The endogenous cell-fate factor dachshund restrains prostate epithelial cell migration via repression of cytokine secretion via a cxcl signaling module.
25487617 2015 The negative regulators of Wnt pathway-DACH1, DKK1, and WIF1 are methylated in oral and oropharyngeal cancer and WIF1 methylation predicts shorter survival.
25416956 2014 A proteome-scale map of the human interactome network.
25410484 2014 Shift in GATA3 functions, and GATA3 mutations, control progression and clinical presentation in breast cancer.
25322986 2014 DACH1 inhibits cyclin D1 expression, cellular proliferation and tumor growth of renal cancer cells.
24912879 2014 Epigenetic silencing of DACH1 induces the invasion and metastasis of gastric cancer by activating TGF-? signalling.
24882577 2015 Gene expression profiling identifies FYN as an important molecule in tamoxifen resistance and a predictor of early recurrence in patients treated with endocrine therapy.
24743895 2014 Silencing DACH1 promotes esophageal cancer growth by inhibiting TGF-? signaling.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24472434 2014 A comprehensive look at transcription factor gene expression changes in colorectal adenomas.
24465431 2014 Familial young-onset diabetes, pre-diabetes and cardiovascular disease are associated with genetic variants of DACH1 in Chinese.
24435167 2014 Functional heterogeneity of PAX5 chimeras reveals insight for leukemia development.
24398877 2014 Upregulation of miR-194 contributes to tumor growth and progression in pancreatic ductal adenocarcinoma.
24392136 2014 DACH1: its role as a classifier of long term good prognosis in luminal breast cancer.
24335958 2014 Cell fate factor DACH1 represses YB-1-mediated oncogenic transcription and translation.
24149323 2013 Epigenetic regulation of DACH1, a novel Wnt signaling component in colorectal cancer.
23492369 2013 Dachshund binds p53 to block the growth of lung adenocarcinoma cells.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22902925 2012 Regulation of HOXA9 activity by predominant expression of DACH1 against C/EBP? and GATA-1 in myeloid leukemia with MLL-AF9.
22889921 2013 Genome-wide association study of obsessive-compulsive disorder.
22781112 2012 [Analysis of the status of DACH1 gene promoter methylation in endometrial carcinoma and its clinical significance].
22405764 2012 DACH1 regulates cell cycle progression of myeloid cells through the control of cyclin D, Cdk 4/6 and p21Cip1.
22379998 2012 Genome-wide mapping for clinically relevant predictors of lamotrigine- and phenytoin-induced hypersensitivity reactions.
22367319 2012 Increased expression of dachshund homolog 1 in ovarian cancer as a predictor for poor outcome.
21750150 2011 Homozygously deleted gene DACH1 regulates tumor-initiating activity of glioma cells.
21558809 2011 The type 1 insulin-like growth factor receptor and resistance to DACH1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20956529 2010 Transcription elongation regulator 1 is a co-integrator of the cell fate determination factor Dachshund homolog 1.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20351289 2010 Attenuation of Forkhead signaling by the retinal determination factor DACH1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19901965 2010 Inhibition of Eyes Absent Homolog 4 expression induces malignant peripheral nerve sheath tumor necrosis.
19605405 2009 The cell fate determination factor DACH1 is expressed in estrogen receptor-alpha-positive breast cancer and represses estrogen receptor-alpha signaling.
19502783 2009 Altered expression of DACH1 and cyclin D1 in endometrial cancer.
19351840 2009 The cell fate determination factor dachshund inhibits androgen receptor signaling and prostate cancer cellular growth.
18957060 2008 Identification of prognostic biomarkers in gastric cancer using endoscopic biopsy samples.
18639284 2008 Identification of novel epigenetic markers for clear cell renal cell carcinoma.
18467491 2008 Dachshund inhibits oncogene-induced breast cancer cellular migration and invasion through suppression of interleukin-8.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17891780 2008 DACH1 negatively regulates the human RANK ligand gene expression in stromal/preosteoblast cells.
16980615 2006 DACH1 is a cell fate determination factor that inhibits cyclin D1 and breast tumor growth.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15818552 2005 The dachshund gene is required for the proper guidance and branching of mushroom body axons in Drosophila melanogaster.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14628042 2003 Eya protein phosphatase activity regulates Six1-Dach-Eya transcriptional effects in mammalian organogenesis.
14563999 2003 Scanning human gene deserts for long-range enhancers.
14525983 2003 DACH1 inhibits transforming growth factor-beta signaling through binding Smad4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12215533 2002 Molecular interaction and synergistic activation of a promoter by Six, Eya, and Dach proteins mediated through CREB binding protein.
12057194 2002 Structure of the retinal determination protein Dachshund reveals a DNA binding motif.
11950062 2002 Impaired interactions between mouse Eyal harboring mutations found in patients with branchio-oto-renal syndrome and Six, Dach, and G proteins.
11543628 2001 DACH: genomic characterization, evaluation as a candidate for postaxial polydactyly type A2, and developmental expression pattern of the mouse homologue.
11025202 2000 Yeast two-hybrid system identifies the ubiquitin-conjugating enzyme mUbc9 as a potential partner of mouse Dac.
10502110 1999 Molecular cloning and expression of the human and mouse homologues of the Drosophila dachshund gene.
10395809 1999 Localization of the human homologue of the Drosophila dachshund gene (DACH) to chromosome 13q21.
9933575 1999 Human (DACH) and mouse (Dach) homologues of Drosophila dachshund map to chromosomes 13q22 and 14E3, respectively.
9651501 1998 Mammalian and Drosophila dachshund genes are related to the Ski proto-oncogene and are expressed in eye and limb.