Property Summary

NCBI Gene PubMed Count 65
PubMed Score 53.63
PubTator Score 51.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.200 3.0e-16
non-inflammatory breast cancer -1.100 6.9e-03

Protein-protein Interaction (6)

Gene RIF (46)

PMID Text
26587829 Infiltrating T cells regulate ERbeta/DAB2IP signals in renal cell carcinoma.
26564738 Data show that colorectal cancer (CRC) patients with lower DAB2 interaction protein (DAB2IP) expression had shorter overall survival time.
26471467 Pretreatment biopsy analysis of DAB2IP identifies subpopulation of high-risk prostate cancer patients with worse survival following radiation therapy
26410305 DAB2IP could inhibit the phosphorylation and transactivation of STAT3, and then subsequently suppress the expression of Twist1 and its target gene P-glycoprotein, both of which were crucial for the pirarubicin chemoresistance.
26336990 Snail and DAB2IP interact to regulate EMT, invasion and metastasis in colorectal cancer
26021979 High glucose increases AIP1 expression and decreases the expression of HIF-1alpha and downstream molecules. Decreased HIF-1alpha signaling may be regulated by increased AIP1 under high glucose.
25841337 miR-889 is an important regulator in ESCC and both miR-889 and DAB2IP may serve as promising biomarkers and therapeutic targets in patients with ESCC.
25604087 strongly expressed in villi and extravillous trophoblasts but not in pre-eclampsia placentas
25454946 Study showed that DAB2IP can be functionally inactivated by physical interaction with mutant p53 proteins with implications for the response of cancer cells to inflammatory cytokines.
25115390 Immunohistochemical study exhibited an inverse correlation between DAB2IP and Skp2 protein expression in the prostate cancer tissue microarray.
25043300 An inverse correlation between CD117 or ZEB1 and DAB2IP is also found in clinical specimens.
24912918 our data indicate that a variety of pathways may pass through DAB2IP to govern cancer development
24684735 downregulation of DAB2IP is associated with features of biologically aggressive urothelial carcinoma of the bladder and results in cell proliferation, migration, and invasion of bladder cancer.
24407031 Human lymphatic endothelial cells with AIP1 small interfering RNA knockdown show attenuated VEGF-C-induced VEGFR-3 signaling.
23838317 This study unveils a new regulation of the Egr-1/Clusterin signaling network by DAB2IP. Loss of DAB2IP expression in CRPC cells signifies their chemoresistance
23604126 DAB2IP is a unique intrinsic androgen receptor modulator in normal cells, and likely can be further developed into a therapeutic agent for rpostate cancer.
23558076 DAB2IP expression was reduced in patients with pancreatic cancer compared with those with no cancer. DAB2IP expression was correlated with the KRAS gene, perineurial invasion and clinical stage of the disease.
23308052 In this study, we show a novel function of DAB2IP in suppressing radiation-induced and DNA-PKcs-associated autophagy and promoting apoptosis in prostate cancer cells.
23246699 Our results for the first time provided new insight into susceptibility factors of hDAB2IP gene variants in carcinogenesis of gastric cancer.
22743059 Both internalization and ASK1-interacting protein-1 association are required for TNFR2-dependent JNK and apoptotic signaling in endothelial cells.
22696229 Studies indicate that DAB2IP and EZH2 are inversely expressed in medulloblastoma.
22168621 Low expression of DAB2IP contributes to malignant development and poor prognosis in hepatocellular carcinoma.
22046421 the 97906A variant genotypes are associated with the increased risk and early onset of lung cancer, particularly in males.
21444365 A sequence variant in DAB2IP on chromosome 9 is associated with coronary heart disease
21071540 Observational study of gene-disease association. (HuGE Navigator)
20622881 the A allele of rs7025486 on 9q33 was found to associate with abdominal aortic aneurysms; Rs7025486 is located within DAB2IP
20622881 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20450899 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20154697 functions as a signaling scaffold that coordinately regulates Ras and NF-kappaB through distinct domains to promote prostate cancer growth and metastasis
20080667 Data show that loss of DAB2IP expression repressed E-cadherin and increased vimentin in both normal prostate epithelial and prostate carcinoma cells as well as in clinical prostate-cancer specimens.
19903888 Data show that DAB2IP is a potent growth inhibitor by inducing G(0)/G(1) cell cycle arrest and is proapoptotic in response to stress, and that DAB2IP can suppress the PI3K-Akt pathway and enhance ASK1 activation leading to cell apoptosis.
19900942 Observational study of gene-disease association. (HuGE Navigator)
19866473 Observational study of gene-disease association. (HuGE Navigator)
19549807 Observational study of gene-disease association. (HuGE Navigator)
19423541 Observational study of gene-disease association. (HuGE Navigator)
18794092 Observational study of gene-disease association. (HuGE Navigator)
18292600 PP2A and DAB2IP cooperatively induce activation of ASK1-JNK signaling and vascular endothelial cell apoptosis.
18073375 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18073375 Analysis of SNPs indicated that one, rs1571801, located in the DAB2IP gene, which encodes a novel Ras GTPase-activating protein and putative prostate tumor suppressor, was associated with aggressive prostate cancer.
16328005 promoter methylation of the hDAB2IP gene is involved in the progression of urinary bladder transitional cell carcinoma from a low to a high malignant potential
15817459 hDAB2IP gene is a target gene of Ezh2 in prostatic epithelium, which provides an underlying mechanism of the down-regulation of hDAB2IP gene in prostate cancer
15386433 Our results demonstrate that hDAB2IP methylation is frequently present in lung cancers and plays a key role in hDAB2IP silencing.
15310755 AIP1 is a novel transducer in TNF-induced TRAF2-dependent activation of ASK1 that mediates a balance between JNK versus NF-kappaB signaling
15041729 hDAB2IP methylation frequently is present in breast cancer and plays a key role in hDAB2IP inactivation.
12446720 Epigenetic regulation of this novel tumor suppressor gene in prostate cancer cell lines.
11944990 Normal prostatic epithelial cells have elevated DAB2IP mRNA compared with cancer cells, which correlates with increased DAB2IP promoter activity.

AA Sequence

MSAGGSARKSTGRSSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSEKSPSMEPSAA      1 - 70
TPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSP     71 - 140
SSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRR    141 - 210
VEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETD    211 - 280
KKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAE    281 - 350
HITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATK    351 - 420
AIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFP    421 - 490
RELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDDRTARTLTLIAKVTQN    491 - 560
LANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVSQ    561 - 630
LEQSIVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRL    631 - 700
PSPTPENKDLFFVTRSSGVQPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVL    701 - 770
PTDGQAAAAQLVAGWPARATPVNLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLP    771 - 840
LSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKGGQPTVPRQNS    841 - 910
AGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDWVGPSTRLRQQSSSSKGDSPE    911 - 980
LKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKDELSQAEKDLAVLQDKLR    981 - 1050
ISTKKLEEYETLFKCQEETTQKLVLEYQARLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEM   1051 - 1120
QAAVDSKQKIIDAQEKRIASLDAANARLMSALTQLKERYSMQARNGISPTNPTKLQITENGEFRNSSNC    1121 - 1189
//

Text Mined References (72)

PMID Year Title
26587829 2015 Infiltrating T cells promote renal cell carcinoma (RCC) progression via altering the estrogen receptor ?-DAB2IP signals.
26564738 2015 Absence of DAB2IP promotes cancer stem cell like signatures and indicates poor survival outcome in colorectal cancer.
26471467 2015 Pretreatment biopsy analysis of DAB2IP identifies subpopulation of high-risk prostate cancer patients with worse survival following radiation therapy.
26410305 2015 DAB2IP regulates the chemoresistance to pirarubicin and tumor recurrence of non-muscle invasive bladder cancer through STAT3/Twist1/P-glycoprotein signaling.
26336990 2015 The positive feedback between Snail and DAB2IP regulates EMT, invasion and metastasis in colorectal cancer.
26021979 2015 High glucose and/or high insulin affects HIF-1 signaling by regulating AIP1 in human umbilical vein endothelial cells.
25841337 2015 miR-889 promotes proliferation of esophageal squamous cell carcinomas through DAB2IP.
25604087 2016 Expression of DAB2IP in human trophoblast and its role in trophoblast invasion.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25454946 2014 Mutant p53 reprograms TNF signaling in cancer cells through interaction with the tumor suppressor DAB2IP.
25115390 2014 The role of homeostatic regulation between tumor suppressor DAB2IP and oncogenic Skp2 in prostate cancer growth.
25043300 2015 DAB2IP regulates cancer stem cell phenotypes through modulating stem cell factor receptor and ZEB1.
24912918 2014 Negative regulation of DAB2IP by Akt and SCFFbw7 pathways.
24684735 2014 Downregulation of DAB2IP results in cell proliferation and invasion and contributes to unfavorable outcomes in bladder cancer.
24407031 2014 AIP1 mediates vascular endothelial cell growth factor receptor-3-dependent angiogenic and lymphangiogenic responses.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23838317 2013 The mechanism of DAB2IP in chemoresistance of prostate cancer cells.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23604126 2014 The role of DAB2IP in androgen receptor activation during prostate cancer progression.
23558076 2013 Decreased expression of DAB2IP in pancreatic cancer with wild-type KRAS.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23308052 2012 DAB2IP regulates autophagy in prostate cancer in response to combined treatment of radiation and a DNA-PKcs inhibitor.
23246699 2013 Association of the variant rs2243421 of human DOC-2/DAB2 interactive protein gene (hDAB2IP) with gastric cancer in the Chinese Han population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22743059 2012 Both internalization and AIP1 association are required for tumor necrosis factor receptor 2-mediated JNK signaling.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22696229 2012 EZH2-regulated DAB2IP is a medulloblastoma tumor suppressor and a positive marker for survival.
22168621 2012 Low expression of DAB2IP contributes to malignant development and poor prognosis in hepatocellular carcinoma.
22046421 2011 A common genetic variant (97906C>A) of DAB2IP/AIP1 is associated with an increased risk and early onset of lung cancer in Chinese males.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21700930 2011 AIP1 prevents graft arteriosclerosis by inhibiting interferon-?-dependent smooth muscle cell proliferation and intimal expansion.
21444365 2012 Association of a sequence variant in DAB2IP with coronary heart disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20622881 2010 Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm.
20450899 2010 Individual and cumulative association of prostate cancer susceptibility variants with clinicopathologic characteristics of the disease.
20154697 2010 An oncogene-tumor suppressor cascade drives metastatic prostate cancer by coordinately activating Ras and nuclear factor-kappaB.
20080667 2010 Role of DAB2IP in modulating epithelial-to-mesenchymal transition and prostate cancer metastasis.
19948740 2010 AIP1 functions as Arf6-GAP to negatively regulate TLR4 signaling.
19903888 2009 DAB2IP coordinates both PI3K-Akt and ASK1 pathways for cell survival and apoptosis.
19900942 2009 Prognostic significance of prostate cancer susceptibility variants on prostate-specific antigen recurrence after radical prostatectomy.
19866473 2010 Association of 17 prostate cancer susceptibility loci with prostate cancer risk in Chinese men.
19549807 2009 Prostate cancer risk associated loci in African Americans.
19423541 2009 Established prostate cancer susceptibility variants are not associated with disease outcome.
19033661 2008 AIP1 functions as an endogenous inhibitor of VEGFR2-mediated signaling and inflammatory angiogenesis in mice.
18794092 2008 Association of prostate cancer risk variants with clinicopathologic characteristics of the disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18292600 2008 AIP1 recruits phosphatase PP2A to ASK1 in tumor necrosis factor-induced ASK1-JNK activation.
18281285 2008 AIP1 is critical in transducing IRE1-mediated endoplasmic reticulum stress response.
18073375 2007 Two genome-wide association studies of aggressive prostate cancer implicate putative prostate tumor suppressor gene DAB2IP.
17389591 2007 RIP1-mediated AIP1 phosphorylation at a 14-3-3-binding site is critical for tumor necrosis factor-induced ASK1-JNK/p38 activation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16328005 2006 Transitional cell carcinomas and nonurothelial carcinomas of the urinary bladder differ in the promoter methylation status of the caveolin-1, hDAB2IP and p53 genes, but not in the global methylation of Alu elements.
15817459 2005 Down-regulation of human DAB2IP gene expression mediated by polycomb Ezh2 complex and histone deacetylase in prostate cancer.
15701637 2005 Tumor necrosis factor alpha-induced desumoylation and cytoplasmic translocation of homeodomain-interacting protein kinase 1 are critical for apoptosis signal-regulating kinase 1-JNK/p38 activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386433 2005 Aberrant promoter methylation of human DAB2 interactive protein (hDAB2IP) gene in lung cancers.
15310755 2004 AIP1/DAB2IP, a novel member of the Ras-GAP family, transduces TRAF2-induced ASK1-JNK activation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15041729 2004 Aberrant promoter methylation in human DAB2 interactive protein (hDAB2IP) gene in breast cancer.
14978793 2004 Identification of a novel RAS GTPase-activating protein (RASGAP) gene at 9q34 as an MLL fusion partner in a patient with de novo acute myeloid leukemia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12813029 2003 AIP1 mediates TNF-alpha-induced ASK1 activation by facilitating dissociation of ASK1 from its inhibitor 14-3-3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446720 2003 Epigenetic regulation of a novel tumor suppressor gene (hDAB2IP) in prostate cancer cell lines.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11944990 2002 Differential regulation of the human gene DAB2IP in normal and malignant prostatic epithelia: cloning and characterization.
11812785 2002 The mechanism of growth-inhibitory effect of DOC-2/DAB2 in prostate cancer. Characterization of a novel GTPase-activating protein associated with N-terminal domain of DOC-2/DAB2.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.