Property Summary

NCBI Gene PubMed Count 102
PubMed Score 174.63
PubTator Score 110.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.424 1.7

Expression

  Differential Expression (37)

Protein-protein Interaction (10)

Gene RIF (64)

PMID Text
26927671 these findings reveal that DAB2 is critical for controlling inflammatory signaling during phenotypic polarization of macrophages
26769181 Data show that miR106b was frequently up-regulated in human cervical carcinoma tumors and cell lines and inversely correlated with DAB2 expression. Its regulation in under TGF-beta1 which contributes to cell migration by targeting DAB2 in cervical carcinoma.
26755607 inhibition of WNT/beta-catenin signaling by DAB2 is essential for establishing the correct number of cardiomyocytes in the developing heart.
26143155 DAB2 regulated the cell migration associated genes in PC3 cells, and the differential DAB2 expression between LNCaP and PC3 cells was partly regulated by histone 4 acetylation.
25892549 These results indicated that miR-93 plays an important role in the initiation and progression of NPC by targeting Dab2 and the miR-93/Dab2 pathway may contribute to the development of novel therapeutic strategies for NPC in the future.
25879443 Dab2 depletion also increases the rescued protein half-life of DeltaF508 CFTR by ~18% and ~91%, respectively
25719979 DAB2 expression is decreased in Non-Small Cell Lung Cancer , and the frequent methylation event at sites -86 to 226 of the DAB2 gene could contribute to the downregulation of DAB2.
25496667 Genome-wide shRNA screening identifies DAB2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25331956 Numb specifically regulates NPC1L1-mediated cholesterol absorption both in human intestine and liver, distinct from ARH and Dab2, which selectively participate in LDLR-mediated LDL uptake.
25253241 Akt1 and Akt2 are involved in albumin endocytosis, and phosphorylation of Dab2 by Akt induces albumin endocytosis in proximal tubule epithelial cells.
24889971 Attenuating Dab2 expression in K562 cells diminished TfR internalization and increased surface levels of TfR concomitantly with a decrease in Tf uptake and erythroid differentiation.
24846918 miR-145 regulates the migration and invasion of highly invasive prostate cancer cells through targeting DAB2 gene
24648493 The data support a model in which Dab2 regulates the domain localization of TbetaRI in the membrane, balancing TGF-beta signaling via the Smad and JNK pathways.
24638085 breast cancer cell was deficient in Dab2 expression and related receptor endocytosis-mediated TGF-beta depletion, which may contribute to the accumulation of TGF-beta in tumor microenvironment and the induction of immune tolerance.
24608456 Reduced Dab2 or loss of Dab2 expression significantly correlates with lower classification of meningiomas and negatively correlates with the invasive ability of adjacent tissues.
24252604 Results suggest that endogenous Dab2 exacerbates central nervous system inflammation, potentially acting to up-regulate reactive oxygen species expression in macrophages and microglia, and that it is of potential pathogenic relevance in multiple sclerosis
24186266 Exposure to follicular fluid transiently increased the transcript levels of IL8 and PTGS2, and decreased the expression of SOD2, GPX3, DAB2, and NR3C1. TNF and IL6 levels were also decreased while those of NAMPT were unaffected.
24002585 Aberrant hypermethylation and reduced expression of disabled-2 promote the development of lung cancers.
23909735 Megalin and Dab2 were expressed in prostate and colon epithelial cells, which was markedly enhanced following treatment with retinoic acid
23005040 The Dab2 gene is inactivated in part by DNA methylation, and the suppression of Dab2 expression by DNA methylation may play a role in the development of myelodysplastic syndrome.
22977233 Data indicate that disabled-2 (Dab2) sulfatide-binding motif contains two helices when embedded in micelles, reversibly binds to sulfatides with moderate affinity, lies parallel to the micelle surface.
22898784 inhibition of Dab2 decreases phosphorylation of SMAD-1, 5, and 8
22705885 These findings thereby define an adaptor-specific mechanism in the control of fibrinogen uptake and implicate that DAB2 is the key adaptor in the clathrin-associated endocytic complexes to mediate fibrinogen internalization.
22648170 These data suggest that Dab2-mediated recruitment of EH domain proteins selectively drives the internalization of the Dab2 cargo, integrin b1.
22399289 Dab2 mediates AP-2 independent recruitment of CFTR to CCVs in polarized human airway epithelial cells.
22323290 FCHO2 regulates the size of clathrin structures, and its interaction with Dab2 is needed for LDLR endocytosis under conditions of low AP2.
22265793 Dab2 is required for the TGFbeta-induced gene expression of angiogenic factors such as VEGF and FGF2
22218591 It was concluded that PKB/Akt is part of an endocytic machinery and it mediates albumin uptake through its interaction with Dab2.
21995445 Dab2 depletion increased the CFTR half-life ~3-fold, in addition to inhibiting CFTR endocytosis.
21725366 Results indicate that miR-187 directly targeted Disabled homolog-2 (Dab2).
21496867 Expressions of Disabled-2 and Axin were concurrently reduced and correlated with the malignant phenotype of lung cancers.
21097498 Dab2 is part of an accommodation of the cell to the altered physicochemical conditions prevalent in mitosis, aimed at allowing endocytic activity throughout the cell cycle.
21063401 Loss of Dab2 expression, commonly observed in breast cancer, may facilitate TGFbeta-stimulated epithelial-to-mesenchymal transition (EMT), and therefore increase the propensity for metastasis.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20592473 DAB2 acts as a tumor suppressor by dictating tumor cell TGF-beta responses, identify a biomarker for squamous cell carcinomas progression.
20525238 Demonstrate frequent DAB2 promoter hypermethylation in nasopharyngeal carcinoma and support the putative tumour suppressor effect of DAB2.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19956625 two pools of Dab2 co-exist at the platelet surface, in both sulfatide- and integrin receptor-bound states, and their balance controls the extent of the clotting response
19855435 Data show that downregulation of myosin VI expression results in a significant reduction in PSA and VEGF secretion in LNCaP cells, and the intracellular targeting seems to involve myosin VI-interacting proteins, GIPC and LMTK2 and Dab2.
19767570 Conditional Dab2 knockout mice maintain normal numbers of circulating regulatory T cells (Tregs), suggesting that DAB2 may be required for amplification, rather than maintenance, of transforming growth factor (TGF)beta signaling.
19581412 Dab2 internalizes integrins freely diffusing on the cell surface and Dab2 regulates migration.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
18582465 These results suggest that DAB2, via Src and focal adhesion signaling, plays a role in human endothelial cell function.
18354201 Doc2alpha-Muunc13-4 system regulates Ca(2+)-dependent secretory lysosome exocytosis in mast cells
18070591 These results suggest that Dab2 is a ligand dependent bi-directional regulator of ERK1,2 activity.
17671122 Decreased DOC-2/DAB2 expression is associated with urothelial carcinoma of the bladder
17115114 analysis of Dab2 protein loss and infrequent promoter hypermethylation in breast cancer
17009406 Loss of Disabled-2 (DAB2) protein expression occurs in early pre-neoplastic stages of development of esophageal cancer and is sustained down the tumorigenic pathway.
16984970 Results suggest that Dab2 is a cargo-specific endocytic adaptor protein, stably associating with phospholipids and clathrin to sort LDLR to nascent-coated pits.
16870701 Dab2 expression is exceptionally low in hepatocytes, likely accounting for the pathological hypercholesterolemia that accompanies ARH loss.
16267015 DOC-2/DAB2 can modulate androgen receptor-mediated cell growth in both normal and malignant prostatic epithelial cells.
16061224 DAB2 expression during megakaryocytic differentiation expression is regulated by platelet-derived growth factor.
15894542 signaling pathway proceeding from the TGFbeta receptors to Dab2 and TAK1, leading to TGFbeta-stimulated JNK activation, FN expression, and cell migration
15280374 findings indicate Ser(24) phosphorylation as a molecular basis for DAB2 acting as a negative regulator in alpha(IIb)beta(3) inside-out signaling
15134832 a binding affinity of Dab phosphotyrosine interaction domain for megalin CT of K(D) = 2.6 x 10(-7) +/- 5.3 x 10(-8)
14669280 Loss in dab-2 expression is correlated with the loss of epithelial basement membrane in morphologically normal areas
14596919 CIN85 association with Dab2 is essential for its recruitment to clathrin coat and appears to be modulated by growth factor stimulation
12805222 Results suggest that disabled-2 functions as a negative regulator of canonical Wnt signaling by stabilizing the beta-catenin degradation complex.
12473651 DOC2 has a role in regulating c-Src in prostatic epithelium and cancer
11812785 mechanism of growth inhibitory effect in prostate cancer

AA Sequence

MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQ      1 - 70
DSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGG     71 - 140
EGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGV    141 - 210
DQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAF    211 - 280
SANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQI    281 - 350
SNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV    351 - 420
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTS    421 - 490
APAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSP    491 - 560
FAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPK    561 - 630
DISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHD    631 - 700
DFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA    701 - 770
//

Text Mined References (111)

PMID Year Title
26927671 2016 Disabled homolog 2 controls macrophage phenotypic polarization and adipose tissue inflammation.
26769181 2016 MicroRNA-106b is involved in transforming growth factor ?1-induced cell migration by targeting disabled homolog 2 in cervical carcinoma.
26755607 2016 Quantitative proteomics identify DAB2 as a cardiac developmental regulator that inhibits WNT/?-catenin signaling.
26143155 2015 Disabled homolog 2 is required for migration and invasion of prostate cancer cells.
25892549 2015 MicroRNA-93 promotes cell growth and invasion in nasopharyngeal carcinoma by targeting disabled homolog-2.
25879443 2015 ?F508 CFTR surface stability is regulated by DAB2 and CHIP-mediated ubiquitination in post-endocytic compartments.
25719979 2015 Aberrant Hypermethylation at Sites -86 to 226 of DAB2 Gene in Non-Small Cell Lung Cancer.
25331956 2014 The clathrin adaptor proteins ARH, Dab2, and numb play distinct roles in Niemann-Pick C1-Like 1 versus low density lipoprotein receptor-mediated cholesterol uptake.
25253241 2014 Akt recruits Dab2 to albumin endocytosis in the proximal tubule.
24889971 2014 Distinct effects of Disabled-2 on transferrin uptake in different cell types and culture conditions.
24846918 2014 [Effects of miR-145 on the migration and invasion of prostate cancer PC3 cells by targeting DAB2].
24648493 2014 Dab2 inhibits the cholesterol-dependent activation of JNK by TGF-?.
24638085 2014 Loss of Dab2 expression in breast cancer cells impairs their ability to deplete TGF-? and induce Tregs development via TGF-?.
24608456 The expression of disabled-2 is common reduced in meningiomas.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24252604 2013 Endogenously regulated Dab2 worsens inflammatory injury in experimental autoimmune encephalomyelitis.
24186266 2014 Altered expression of inflammation-associated genes in oviductal cells following follicular fluid exposure: implications for ovarian carcinogenesis.
24002585 2013 Aberrant hypermethylation and reduced expression of disabled-2 promote the development of lung cancers.
23909735 2013 Vitamin D transport proteins megalin and disabled-2 are expressed in prostate and colon epithelial cells and are induced and activated by all-trans-retinoic acid.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23005040 2012 Aberrant promoter methylation of Dab2 gene in myelodysplastic syndrome.
22977233 2012 Structure, sulfatide binding properties, and inhibition of platelet aggregation by a disabled-2 protein-derived peptide.
22898784 2012 Context-dependent proangiogenic function of bone morphogenetic protein signaling is mediated by disabled homolog 2.
22705885 2012 The endocytic adaptor protein Disabled-2 is required for cellular uptake of fibrinogen.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
22491013 2012 Disabled-2 (Dab2) inhibits Wnt/?-catenin signalling by binding LRP6 and promoting its internalization through clathrin.
22484487 2012 Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning.
22399289 2012 Disabled-2 protein facilitates assembly polypeptide-2-independent recruitment of cystic fibrosis transmembrane conductance regulator to endocytic vesicles in polarized human airway epithelial cells.
22323290 2012 FCH domain only-2 organizes clathrin-coated structures and interacts with Disabled-2 for low-density lipoprotein receptor endocytosis.
22265793 2012 Dab2 is pivotal for endothelial cell migration by mediating VEGF expression in cancer cells.
22218591 2012 PKB/Akt partners with Dab2 in albumin endocytosis.
22158540 2011 Genome-wide association study identifies five loci associated with susceptibility to pancreatic cancer in Chinese populations.
21995445 2012 Dab2 is a key regulator of endocytosis and post-endocytic trafficking of the cystic fibrosis transmembrane conductance regulator.
21725366 2012 Regulation of ovarian cancer progression by microRNA-187 through targeting Disabled homolog-2.
21573318 1993 Identification of differentially expressed RNA in human ovarian-carcinoma cells by arbitrarily primed PCR fingerprinting of total rnas.
21496867 2011 Disabled-2 and Axin are concurrently colocalized and underexpressed in lung cancers.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21097498 2011 Negative regulation of the endocytic adaptor disabled-2 (Dab2) in mitosis.
21063401 2010 Disabled-2 downregulation promotes epithelial-to-mesenchymal transition.
20936779 2010 A human MAP kinase interactome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20592473 2010 Epigenetic downregulation of human disabled homolog 2 switches TGF-beta from a tumor suppressor to a tumor promoter.
20525238 2010 Putative tumour-suppressor gene DAB2 is frequently down regulated by promoter hypermethylation in nasopharyngeal carcinoma.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19956625 2009 Sulfatides partition disabled-2 in response to platelet activation.
19855435 2010 Overexpression of myosin VI in prostate cancer cells enhances PSA and VEGF secretion, but has no effect on endocytosis.
19767570 2009 Cutting edge: Dab2 is a FOXP3 target gene required for regulatory T cell function.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19306879 2009 Focal adhesion disassembly requires clathrin-dependent endocytosis of integrins.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18582465 2008 Morphogenesis of human endothelial cells is inhibited by DAB2 via Src.
18354201 2008 Doc2 alpha and Munc13-4 regulate Ca(2+) -dependent secretory lysosome exocytosis in mast cells.
18070591 2008 Role played by disabled-2 in albumin induced MAP Kinase signalling.
17671122 2007 Decreased DOC-2/DAB2 expression in urothelial carcinoma of the bladder.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17115114 2007 Frequent loss of Dab2 protein and infrequent promoter hypermethylation in breast cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17009406 2006 Loss of disabled-2 expression is an early event in esophageal squamous tumorigenesis.
16984970 2006 The adaptor protein Dab2 sorts LDL receptors into coated pits independently of AP-2 and ARH.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16870701 2006 A single common portal for clathrin-mediated endocytosis of distinct cargo governed by cargo-selective adaptors.
16267015 2005 The role of DOC-2/DAB2 in modulating androgen receptor-mediated cell growth via the nongenomic c-Src-mediated pathway in normal prostatic epithelium and cancer.
16061224 2005 Autocrine signaling of platelet-derived growth factor regulates disabled-2 expression during megakaryocytic differentiation of K562 cells.
15894542 2005 Disabled-2 (Dab2) mediates transforming growth factor beta (TGFbeta)-stimulated fibronectin synthesis through TGFbeta-activated kinase 1 and activation of the JNK pathway.
15837803 2005 Optineurin links myosin VI to the Golgi complex and is involved in Golgi organization and exocytosis.
15734730 2005 Disabled-2 (Dab2) is required for transforming growth factor beta-induced epithelial to mesenchymal transition (EMT).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15280374 2004 Disabled-2 is a negative regulator of integrin alpha(IIb)beta(3)-mediated fibrinogen adhesion and cell signaling.
15247260 2004 Myosin VI regulates endocytosis of the cystic fibrosis transmembrane conductance regulator.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15134832 2004 The adaptor disabled-2 binds to the third psi xNPxY sequence on the cytoplasmic tail of megalin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14669280 2003 Loss of surface and cyst epithelial basement membranes and preneoplastic morphologic changes in prophylactic oophorectomies.
14596919 2003 Dab2 links CIN85 with clathrin-mediated receptor internalization.
12881709 2003 Cell cycle-dependent phosphorylation of Disabled-2 by cdc2.
12857860 2003 Myo6 facilitates the translocation of endocytic vesicles from cell peripheries.
12853125 2003 Inhibitory actions of genistein in human breast cancer (MCF-7) cells.
12805222 2003 Regulation of the Wnt signaling pathway by disabled-2 (Dab2).
12606711 2003 Integrin beta cytoplasmic domain interactions with phosphotyrosine-binding domains: a structural prototype for diversity in integrin signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473651 2003 Characterization of a novel negative regulator (DOC-2/DAB2) of c-Src in normal prostatic epithelium and cancer.
11967127 2002 Myosin VI binds to and localises with Dab2, potentially linking receptor-mediated endocytosis and the actin cytoskeleton.
11927540 2002 Dual roles for the Dab2 adaptor protein in embryonic development and kidney transport.
11906161 2002 DOC-2/DAB2 is the binding partner of myosin VI.
11812785 2002 The mechanism of growth-inhibitory effect of DOC-2/DAB2 in prostate cancer. Characterization of a novel GTPase-activating protein associated with N-terminal domain of DOC-2/DAB2.
11387212 2001 The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway.
11371563 2001 The inhibitory role of DOC-2/DAB2 in growth factor receptor-mediated signal cascade. DOC-2/DAB2-mediated inhibition of ERK phosphorylation via binding to Grb2.
11247302 2001 Disabled-2 colocalizes with the LDLR in clathrin-coated pits and interacts with AP-2.
11161789 2000 Structure, sequence, and promoter analysis of human disabled-2 gene (DAB2).
11039902 2000 Restoration of positioning control following Disabled-2 expression in ovarian and breast tumor cells.
10769163 2000 Cytosolic adaptor protein Dab2 is an intracellular ligand of endocytic receptor gp600/megalin.
10542228 1999 The role of DOC-2/DAB2 protein phosphorylation in the inhibition of AP-1 activity. An underlying mechanism of its tumor-suppressive function in prostate cancer.
10340382 1999 Disabled-2 inactivation is an early step in ovarian tumorigenicity.
9620555 1998 DOC-2, a candidate tumor suppressor gene in human epithelial ovarian cancer.
9569023 1998 Disabled-2 (Dab2) is an SH3 domain-binding partner of Grb2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8660969 1996 Sequence, genomic structure, and chromosomal assignment of human DOC-2.
8314147 1994 Molecular cloning of differentially expressed genes in human epithelial ovarian cancer.