Property Summary

NCBI Gene PubMed Count 60
PubMed Score 3.38
PubTator Score 74.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.200 1.1e-03
posterior fossa group A ependymoma -3.400 1.5e-14
oligodendroglioma -2.000 1.1e-03
glioblastoma -2.400 2.1e-03
osteosarcoma 1.176 3.6e-07
atypical teratoid / rhabdoid tumor -2.200 4.7e-04
medulloblastoma, large-cell 1.200 6.4e-03
intraductal papillary-mucinous adenoma (... -1.100 2.7e-03
lung cancer -1.100 4.4e-02
interstitial cystitis -2.500 1.4e-05
adult high grade glioma -2.300 1.1e-03
group 3 medulloblastoma 2.600 7.6e-04
subependymal giant cell astrocytoma -2.665 2.4e-02
Breast cancer -2.100 3.1e-02

Protein-protein Interaction (4)

Gene RIF (31)

PMID Text
26270645 Study shows that early neural cells transiently express Reelin at the time they leave the presumptive olfactory/vomeronasal epithelium and that Dab 1 is present in the migratory cell mass and in the presumptive ensheathing cells in the absence of reelin.
26028559 this study is the first to provide genetic evidence for DAB1 as a candidate AD liability/protection gene, although the strength of the contribution of DAB1 may differ among populations
24844606 results of this study demonstrated the presence of reelin, its receptors VLDLR and ApoER2 as well as Dab1 in the ENS and might indicate a novel role of the reelin system in regulating neuronal plasticity and pre-synaptic functions in the ENS.
23333377 The finding of this study suggested that variations in DAB1 involved in the Reelin signaling pathway might contribute to genetic susceptibility to autism with Chinese Han decent.
22419519 Variation in genes encoding proteins at the gateway of Reelin signaling: ligands RELN and APOE, their common receptors APOER2 and VLDLR, and adaptor DAB1, was examined.
22394407 show that Reelin-stimulated Notch-1 activation is dependent on Reelin signaling
22163036 alternative splicing of Dab1 is conserved in avian and mammalian species, with Dab1-L driving SFK phosphorylation in both species
21453247 we report for the first time, that DAB1 is significantly up-regulated in human frontal cortex brain samples of Alzheimer disease patients
21315259 Dab1, an essential component of the reelin pathway, is required for glia-independent somal translocation in the neocortex.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600896 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20568118 Fe65 and Dab1 compete for binding to APP. Dab1 significantly decreased the amount of APP bound to LRP and the level of secreted APP and APP-CTF in LRP expressing cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19853035 Thus, the present observations suggest a correlation between Dab1 phosphorylation, Abeta deposition and PrP(sc) type in sCJD.
19116273 ligation of ApoER2 by APC signals via Dab1 phosphorylation and subsequent activation of PI3K and Akt and inactivation of GSK3beta, thereby contributing to APC's beneficial effects on cells.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18089558 Fyn, due in part to its effects on Dab1, regulates the phosphorylation, trafficking, and processing of APP and apoEr2.
18008369 Resides within an unstable common fragile site region and might play a role in human tumorigenesis.
17974915 Cul5 plays an essential role in regulating neuron migrations during cortical development, possibly by opposing a promigratory effect of Dab1.
17548821 DAB1 phosphorylation occurs solely in the segment spanning the 5th and 6th reelin repeats.
17062576 results suggest that the mouse ortholog is a nucleocytoplasmic shuttling protein
16951405 The effect of Dab1 on APP and apoEr2 processing in transfected cells and primary neurons is reported.
16481437 After Reelin binds to the receptors, Disabled-1 becomes phosphorylated on tyrosine residues, initiating a signaling cascade that includes activation of Src-family kinases and Akt.
15883038 phosphoinositide-binding region within Dab1 PTB domain is required for membrane localization and basal tyrosine phosphorylation of Dab1
15718228 Dab1 regulates both cell surface expression and internalization of Reelin receptors
15175076 significantly lower levels of disabled homolog 1 gene transcripts were detected in gangliogliomas compared to controls
14961563 Dab1 immunoreactivity is found in certain populations of amacrine cells of the retina, with lobular appendages in the outer half of the inner plexiform layer (IPL) and a bushy, smooth dendritic tree in the inner half of the IPL.
12834112 RELN and DAB1 coexpression in these neurons is necessary for both normal cortical development and mature function.
12581169 involvement of disabled homolog 1 in neurogenesis
12446734 This gene, is an intracellular adaptor of the Reelin pathway and reveals unusual complexity in human and mouse.

AA Sequence

MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKG      1 - 70
VVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVA     71 - 140
IKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPI    141 - 210
RDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLE    211 - 280
LFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLV    281 - 350
QQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPL    351 - 420
ATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQMAQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTD    421 - 490
DCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDG    491 - 560
SQASSNSDPFGEPSGEPSGDNISPQAGS                                              561 - 588
//

Text Mined References (63)

PMID Year Title
26441085 2015 AKT-independent Reelin signaling requires interactions of heterotrimeric Go and Src.
26270645 2015 Human Neural Cells Transiently Express Reelin during Olfactory Placode Development.
26028559 2015 Functional enrichment analysis of three Alzheimer's disease genome-wide association studies identities DAB1 as a novel candidate liability/protective gene.
25416956 2014 A proteome-scale map of the human interactome network.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24844606 2014 Expression and regulation of reelin and its receptors in the enteric nervous system.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23568457 2013 Genetic variants associated with disordered eating.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23333377 2013 Association study between genes in Reelin signaling pathway and autism identifies DAB1 as a susceptibility gene in a Chinese Han population.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22419519 2012 Impact of the Reelin signaling cascade (ligands-receptors-adaptor complex) on cognition in schizophrenia.
22394407 2012 Reelin regulates differentiation of neural stem cells by activation of notch signaling through Disabled-1 tyrosine phosphorylation.
22163036 2011 Disabled-1 alternative splicing in human fetal retina and neural tumors.
21453247 2011 The AICD interacting protein DAB1 is up-regulated in Alzheimer frontal cortex brain samples and causes deregulation of proteins involved in gene expression changes.
21315259 2011 Reelin regulates cadherin function via Dab1/Rap1 to control neuronal migration and lamination in the neocortex.
21221998 2011 A genome-wide association analysis reveals 1p31 and 2p13.3 as susceptibility loci for Kawasaki disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600896 2010 Genome-wide association study of vitamin D concentrations in Hispanic Americans: the IRAS family study.
20568118 2010 Dab1 binds to Fe65 and diminishes the effect of Fe65 or LRP1 on APP processing.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19853035 2010 Involvement of Dab1 in APP processing and beta-amyloid deposition in sporadic Creutzfeldt-Jakob patients.
19116273 2009 Activated protein C ligation of ApoER2 (LRP8) causes Dab1-dependent signaling in U937 cells.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18089558 2008 Fyn modulation of Dab1 effects on amyloid precursor protein and ApoE receptor 2 processing.
18008369 2008 Disabled-1 is a large common fragile site gene, inactivated in multiple cancers.
17974915 2007 Cullin 5 regulates Dab1 protein levels and neuron positioning during cortical development.
17548821 2007 Structure of a receptor-binding fragment of reelin and mutational analysis reveal a recognition mechanism similar to endocytic receptors.
17062576 2006 Mouse Disabled1 (DAB1) is a nucleocytoplasmic shuttling protein.
16951405 2006 DAB1 and Reelin effects on amyloid precursor protein and ApoE receptor 2 trafficking and processing.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16481437 2006 Functional dissection of Reelin signaling by site-directed disruption of Disabled-1 adaptor binding to apolipoprotein E receptor 2: distinct roles in development and synaptic plasticity.
15883038 2005 Signaling through Disabled 1 requires phosphoinositide binding.
15718228 2005 Disabled1 regulates the intracellular trafficking of reelin receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15272003 2004 Serine and threonine phosphorylation of the low density lipoprotein receptor-related protein by protein kinase Calpha regulates endocytosis and association with adaptor molecules.
15175076 2004 The reelin pathway components disabled-1 and p35 in gangliogliomas--a mutation and expression analysis.
15062102 2004 Activation of a Dab1/CrkL/C3G/Rap1 pathway in Reelin-stimulated neurons.
14961563 2004 AII amacrine cells in the mammalian retina show disabled-1 immunoreactivity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14578885 2003 Interaction of reelin signaling and Lis1 in brain development.
12834112 2003 Reelin and disabled-1 expression in developing and mature human cortical neurons.
12646221 2003 Inhibition of ubiquitin ligase Siah-1A by disabled-1.
12606711 2003 Integrin beta cytoplasmic domain interactions with phosphotyrosine-binding domains: a structural prototype for diversity in integrin signaling.
12581169 2003 Disabled-1 mRNA and protein expression in developing human cortex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446734 2003 The gene encoding disabled-1 (DAB1), the intracellular adaptor of the Reelin pathway, reveals unusual complexity in human and mouse.
12077184 2002 Cyclin-dependent kinase 5 phosphorylates disabled 1 independently of Reelin signaling.
11812785 2002 The mechanism of growth-inhibitory effect of DOC-2/DAB2 in prostate cancer. Characterization of a novel GTPase-activating protein associated with N-terminal domain of DOC-2/DAB2.
11716507 2001 Disabled-1 interacts with a novel developmentally regulated protocadherin.
11279201 2001 Identification of reelin-induced sites of tyrosyl phosphorylation on disabled 1.
11137154 2000 The evolution of cortical development. An hypothesis based on the role of the Reelin signaling pathway.
10959835 2000 Dab1 tyrosine phosphorylation sites relay positional signals during mouse brain development.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10460257 1999 Disabled-1 binds to the cytoplasmic domain of amyloid precursor-like protein 1.
10380922 1999 Reeler/Disabled-like disruption of neuronal migration in knockout mice lacking the VLDL receptor and ApoE receptor 2.
10373567 1999 The disabled 1 phosphotyrosine-binding domain binds to the internalization signals of transmembrane glycoproteins and to phospholipids.
9837937 1998 Interaction of cytosolic adaptor proteins with neuronal apolipoprotein E receptors and the amyloid precursor protein.
9790777 1998 Cloning of human DAB1 and mapping to chromosome 1p31-p32.
9716537 1998 Disabled-1 acts downstream of Reelin in a signaling pathway that controls laminar organization in the mammalian brain.