Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession D6RF30
Symbols

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAEETQHNKLAAAKKKLKEYWQKNSPRVPAGANRNRKTNGSIPEKATSGGCQPPRDSATGFHREGPTSSA      1 - 70
TLKDLESPCQERAVVLDSRSVEISQLKNTIKSLKQQKKQVEHQLEEEKKANNKKQKAKRVLEVQIQTLNI     71 - 140
QKEELNTDLYHMKRSLRYFEEKSKDLAVRLQHSLQRKGELESVLSNVMATQKKKANQLSSRSKARTEWKL    141 - 210
EQSMREEALLKVQLTQLKESFQQVQLERDEYSEHLKGERARWQQRMRKMSQEICTLKKEKQQDMRRVEKL    211 - 280
ERSLSKLKNQMAEPLPPEPPAVPSEVELQHLRKELERVAGELQAQVKKNQRISLLNQRQEERIQEQEERL    281 - 350
RKQEERIQEQHKSLQQLAKPQSVFEEPEHLEAASQQNQQLTAQLSLMALPGEGHGEHLDSEGEEAPQPMP    351 - 420
SVPEDLESREAMSSFMDHLKEKADLSELVKKELCFIHHWRDRRHQKTHHLLSEPGGCAKDAALGGGHHQA    421 - 490
GAQGGDEGEAAGAAADGIAAYSNYNNGHRKFLAAAHNPADEPGPGAPAPQELGAADKHGDLREVSLTSSA    491 - 560
QGEAREDPLLDKPTAQPIVQDHKEHPGLGSNCCVPLFCWAWLPRRRR                           561 - 607
//

Text Mined References (2)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.