Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
ovarian cancer 8,484
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 0.000
psoriasis 2.000 0.000

AA Sequence

MPRSCRERVQGSKQQLRLQFPPRIRKTPKLTFYRPDNILVKLNTTAILREGALYQRQVEQELQRVDKLVD      1 - 70
GAGDFSEFFEWQKKMQAKDREEQLAASECRRLQGKLSHEEAVLARQSLMQENKQRVEQQKEQMAKLMLQR     71 - 140
AERRLREDRSRKELVEQVIEGQKNAKAAQTKLAKGRQQTVQEAIEESRGLLQRRAQAAQEEQRRRCELIS    141 - 210
QLRALETQPTRKGKLVDLTQIPGYGLEGEMSIVELRERLALLKENQRRKEEEKRDQIIQGKHTKSQELQN    211 - 280
MVEQISLCRAAMGRSAALRWEEKKALAAAPAAPSQDERVQQLRRRISERAAERSRQAALLHVSAPRTARP    281 - 350
KPRVSPDWWEEPGRLKAGAGWGWRARRAGTGVPGRGWRGDRVRSAAGRYAAAGAGGGGGVPARADAFPGL    351 - 420
QAQLEAQHWLELERSRERRLQALQQGGSGPGPARRLEAA                                   421 - 459
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.