Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.9e-15
ovarian cancer 8520 5.3e-11

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 5.3e-11
psoriasis 2.000 4.9e-15

AA Sequence

MPRSCRERVQGSKQQLRLQFPPRIRKTPKLTFYRPDNILVKLNTTAILREGALYQRQVEQELQRVDKLVD      1 - 70
GAGDFSEFFEWQKKMQAKDREEQLAASECRRLQGKLSHEEAVLARQSLMQENKQRVEQQKEQMAKLMLQR     71 - 140
AERRLREDRSRKELVEQVIEGQKNAKAAQTKLAKGRQQTVQEAIEESRGLLQRRAQAAQEEQRRRCELIS    141 - 210
QLRALETQPTRKGKLVDLTQIPGYGLEGEMSIVELRERLALLKENQRRKEEEKRDQIIQGKHTKSQELQN    211 - 280
MVEQISLCRAAMGRSAALRWEEKKALAAAPAAPSQDERVQQLRRRISERAAERSRQAALLHVSAPRTARP    281 - 350
KPRVSPDWWEEPGRLKAGAGWGWRARRAGTGVPGRGWRGDRVRSAAGRYAAAGAGGGGGVPARADAFPGL    351 - 420
QAQLEAQHWLELERSRERRLQALQQGGSGPGPARRLEAA                                   421 - 459
//

Text Mined References (2)

PMID Year Title