Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.78
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.2e-40
Disease Target Count Z-score Confidence
Glaucoma 239 3.531 1.8
Ocular hypertension 42 3.051 1.5

Gene RIF (4)

AA Sequence

MENEDGYMTLSFKNRCKSKQKSKDFSLYPQYYCLLLIFGCIVILIFIMTGIDLKFWHKKMDFSQNVNVSS      1 - 70
LSGHNYLCPNDWLLNEGKCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLDELEFIQNSLKPGHFGWIGLY     71 - 140
VTFQGNLWMWIDEHFLVPELFSVIGPTDDRSCAVITGNWVYSEDCSSTFKGICQRDAILTHNGTSGV       141 - 207
//

Text Mined References (5)

PMID Year Title