Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.65
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Glaucoma 134 3.417 1.7
psoriasis 6,685

Gene RIF (3)

PMID Text
25510854 Key residues at the membrane-distal surface of KACL, but not glycosylation, determine the functional interaction of the keratinocyte-specific C-type lectin-like receptor KACL with its high-affinity receptor NKp65
23803857 structure explains the exceptionally high affinity of the NKp65-KACL interaction compared with other cell-cell interaction pairs, which may compensate for the monomeric nature of NKp65 to achieve cell activation
20194751 Keratinocytes express KACL and are capable of stimulating NKp65-expressing cells in a KACL-dependent manner.

AA Sequence

MENEDGYMTLSFKNRCKSKQKSKDFSLYPQYYCLLLIFGCIVILIFIMTGIDLKFWHKKMDFSQNVNVSS      1 - 70
LSGHNYLCPNDWLLNEGKCYWFSTSFKTWKESQRDCTQLQAHLLVIQNLDELEFIQNSLKPGHFGWIGLY     71 - 140
VTFQGNLWMWIDEHFLVPELFSVIGPTDDRSCAVITGNWVYSEDCSSTFKGICQRDAILTHNGTSGV       141 - 207
//

Text Mined References (4)

PMID Year Title
25510854 2015 Key residues at the membrane-distal surface of KACL, but not glycosylation, determine the functional interaction of the keratinocyte-specific C-type lectin-like receptor KACL with its high-affinity receptor NKp65.
23803857 2013 Structure of NKp65 bound to its keratinocyte ligand reveals basis for genetically linked recognition in natural killer gene complex.
20194751 2010 Interaction of C-type lectin-like receptors NKp65 and KACL facilitates dedicated immune recognition of human keratinocytes.
16541075 2006 The finished DNA sequence of human chromosome 12.