Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession D3DTV9
Symbols C17orf93
HOXB-AS5
HOXB13-AS1
NCRNA00253

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
12746837 PRAC2 may have a function in prostate growth and development(PRAC2)

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPG      1 - 70
RWKPVAPRTMKACPQVLLEW                                                       71 - 90
//

Text Mined References (2)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
12746837 2003 PRAC2: a new gene expressed in human prostate and prostate cancer.