Property Summary

NCBI Gene PubMed Count 20
PubMed Score 84.47
PubTator Score 63.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia 1.100 4.9e-02
adult high grade glioma 1.800 6.1e-04
Astrocytoma, Pilocytic 1.600 4.1e-06
colon cancer -1.900 9.3e-03
cutaneous lupus erythematosus 2.500 1.1e-03
glioblastoma 1.600 2.5e-05
interstitial cystitis 2.000 8.8e-03
intraductal papillary-mucinous adenoma (... 1.800 3.4e-02
invasive ductal carcinoma 2.200 2.9e-03
lung cancer -3.700 1.4e-05
lung carcinoma -3.300 6.4e-26
non-small cell lung cancer -1.054 3.0e-06
osteosarcoma -1.963 2.9e-02
ovarian cancer -1.700 8.3e-05
periodontitis 1.700 4.2e-28
posterior fossa group A ependymoma 1.300 3.9e-06
primary Sjogren syndrome 1.400 1.3e-02
psoriasis 1.300 1.0e-03
ulcerative colitis 3.200 2.8e-06

Gene RIF (8)

AA Sequence

MSLQRLLQHSSNGNLADFCAGPAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDF      1 - 70
SWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTE     71 - 140
GFTYKQVVDLIRSSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANC    141 - 210
PSLENMDLDELSLFGPLPGPGPALVDRNRLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTST    211 - 280
DDECFIPKEGDDFLRRSSSRRNRSISNTSSGSMSPLWEGNLSSMFGTLPRKSRKGSVRKQLLKFIPGLHR    281 - 350
AVEEEESRF                                                                 351 - 359
//

Text Mined References (22)

PMID Year Title