Property Summary

NCBI Gene PubMed Count 20
PubMed Score 81.33
PubTator Score 63.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
cutaneous lupus erythematosus 2.500 1.1e-03
psoriasis 1.300 1.0e-03
osteosarcoma -1.963 2.9e-02
glioblastoma 1.700 1.7e-03
periodontitis 1.700 4.2e-28
non-small cell lung cancer -1.054 3.0e-06
intraductal papillary-mucinous adenoma (... 1.800 3.4e-02
colon cancer -1.900 9.3e-03
lung cancer -4.000 2.0e-06
interstitial cystitis 2.200 2.4e-04
adult high grade glioma 1.800 6.1e-04
pilocytic astrocytoma 1.600 3.1e-06
posterior fossa group A ependymoma 1.300 3.9e-06
primary Sjogren syndrome 1.400 1.3e-02
lung carcinoma -3.800 3.2e-30
invasive ductal carcinoma 2.200 2.9e-03
acute myeloid leukemia 1.600 1.8e-02
ulcerative colitis 3.200 2.8e-06
ovarian cancer 1.800 4.1e-03

Synonym

Accession O60759 B4DWH9 Q15630 Q8NE32
Symbols HE
B3-1
CASP
CYBR
CYTHIP
PSCDBP

Gene

PDB

2Z17  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

PMID Text
25058460 CASP has a direct role in the secretion of IFN-gamma, and NK cell motility and ability to kill tumor cells. CASP polarizes to the leading edge of migrating NK cells, and to the immunological synapse when engaged with tumor cells.
23469018 a newly identified binding partner of CYTIP, SOCS-1, and confirm its function in regulating the degradation of CYTIP by the proteasome
23223005 loss of DNA methylation enables HIF-driven cytohesin 1 interacting protein expression to protect cancer cells from death cytokine signals
21562043 on infection of human monocyte-derived dendritic cells with herpes simplex virus type 1 (HSV-1), CYTIP is rapidly degraded and as a consequence beta-2 integrins, predominantly LFA-1, are activated
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17577583 These results suggest that endosomal SNX27 may recruit CASP to orchestrate intracellular trafficking and/or signaling complexes.
16702224 Cybr not only regulates lymphocyte adhesion and cell-cell interaction but also contributes to the regulation of the signaling cascade and of the genetic program downstream of the T cell receptor.
12052827 observations suggest that CASP is a scaffolding protein that facilitates the function of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli

AA Sequence

MSLQRLLQHSSNGNLADFCAGPAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDF      1 - 70
SWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTE     71 - 140
GFTYKQVVDLIRSSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANC    141 - 210
PSLENMDLDELSLFGPLPGPGPALVDRNRLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTST    211 - 280
DDECFIPKEGDDFLRRSSSRRNRSISNTSSGSMSPLWEGNLSSMFGTLPRKSRKGSVRKQLLKFIPGLHR    281 - 350
AVEEEESRF                                                                 351 - 359
//

Text Mined References (22)

PMID Year Title
25058460 2014 Cytohesin-associated scaffolding protein (CASP) is involved in migration and IFN-? secretion in natural killer cells.
23469018 2013 In human monocyte derived dendritic cells SOCS1 interacting with CYTIP induces the degradation of CYTIP by the proteasome.
23223005 2013 Epigenetic expansion of VHL-HIF signal output drives multiorgan metastasis in renal cancer.
21562043 2011 Infection of dendritic cells with herpes simplex virus type 1 induces rapid degradation of CYTIP, thereby modulating adhesion and migration.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20530790 2010 LFA-1 activity state on dendritic cells regulates contact duration with T cells and promotes T-cell priming.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18926288 2008 Cybr, CYTIP or CASP: an attempt to pinpoint a molecule's functions and names.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17577583 2007 Sorting nexin 27 interacts with the Cytohesin associated scaffolding protein (CASP) in lymphocytes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16702224 2006 Cytohesin binder and regulator augments T cell receptor-induced nuclear factor of activated T Cells.AP-1 activation through regulation of the JNK pathway.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12606567 2003 Attenuation of cell adhesion in lymphocytes is regulated by CYTIP, a protein which mediates signal complex sequestration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12052827 2002 The N-terminal coiled coil domain of the cytohesin/ARNO family of guanine nucleotide exchange factors interacts with the scaffolding protein CASP.
11867758 2002 Cybr, a cytokine-inducible protein that binds cytohesin-1 and regulates its activity.
10343115 1999 Assignment of the human B3-1 gene (PSCDBP) to chromosome 2 band q11.2 by radiation hybrid mapping.
8241278 1993 Cloning a cDNA from human NK/T cells which codes for an unusual leucine zipper containing protein.