Property Summary

NCBI Gene PubMed Count 19
PubMed Score 68.39
PubTator Score 51.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.400 1.2e-05
osteosarcoma 1.012 1.2e-03
atypical teratoid / rhabdoid tumor -1.200 1.3e-04
medulloblastoma, large-cell -1.500 2.1e-05
primary pancreatic ductal adenocarcinoma 1.135 2.0e-02
tuberculosis -1.500 6.5e-07
Polycystic Ovary Syndrome -1.086 4.2e-03
invasive ductal carcinoma -1.100 2.1e-02
ovarian cancer -1.300 6.6e-06

Gene RIF (4)

PMID Text
24966920 Cytohesin-3 was upregulated in hepatocellular carcinoma tissues, correlating with overall survival/relapse-free survival and tumor size/vascular invasion.
22454518 The PH domains of cytohesin 2/ARNO and cytohesin 3/GRP1 are responsible for the differential effects of these proteins on cell adhesion to fibronectin.
21932773 incorporation of the E345K charge reversal mutation into the GRP1 PH domain enhances PI(4,5)P(2) affinity 8-fold and yields constitutive plasma membrane targeting in cells
15878955 GRP1 is a new corepressor for thyroid hormone receptors, which modulates both positive and negative regulation by T3 by decreasing TR-complex formation on thyroid response elements

AA Sequence

MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQI      1 - 70
AMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEF     71 - 140
ADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVR    141 - 210
DKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVK    211 - 280
TWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGR    281 - 350
VVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK                        351 - 400
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24966920 2014 Cytohesin-3 is upregulated in hepatocellular carcinoma and contributes to tumor growth and vascular invasion.
23940353 2013 Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.
22454518 2012 Phosphoinositide specificity determines which cytohesins regulate ?1 integrin recycling.
21932773 2011 The GRP1 PH domain, like the AKT1 PH domain, possesses a sentry glutamate residue essential for specific targeting to plasma membrane PI(3,4,5)P(3).
18084281 2008 GEP100 links epidermal growth factor receptor signalling to Arf6 activation to induce breast cancer invasion.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15878955 2005 General receptor for phosphoinositides 1, a novel repressor of thyroid hormone receptor action that prevents deoxyribonucleic acid binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10828067 2000 Interaction of GRASP, a protein encoded by a novel retinoic acid-induced gene, with members of the cytohesin family of guanine nucleotide exchange factors.
10652308 2000 Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors.
9742223 1998 Nerve growth factor- and epidermal growth factor-stimulated translocation of the ADP-ribosylation factor-exchange factor GRP1 to the plasma membrane of PC12 cells requires activation of phosphatidylinositol 3-kinase and the GRP1 pleckstrin homology domain.
9707577 1998 ARNO3, a Sec7-domain guanine nucleotide exchange factor for ADP ribosylation factor 1, is involved in the control of Golgi structure and function.
9072969 1997 Signaling by phosphoinositide-3,4,5-trisphosphate through proteins containing pleckstrin and Sec7 homology domains.