Property Summary

NCBI Gene PubMed Count 53
PubMed Score 0.00
PubTator Score 132.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 1.300 5.0e-02
osteosarcoma -1.598 2.2e-03
group 4 medulloblastoma 1.900 2.0e-05
atypical teratoid / rhabdoid tumor 1.600 1.1e-04
primitive neuroectodermal tumor 1.500 1.4e-04
adrenocortical carcinoma 1.491 4.0e-04
intraductal papillary-mucinous carcinoma... 1.800 9.4e-04
intraductal papillary-mucinous neoplasm ... 1.500 3.2e-04
lung cancer 1.100 2.4e-04
diabetes mellitus -1.200 1.7e-03
Breast cancer 3.600 2.2e-02
ductal carcinoma in situ 1.600 8.8e-04
invasive ductal carcinoma 1.800 2.0e-03
ovarian cancer 1.400 9.0e-05

Gene RIF (26)

PMID Text
27203102 Authors' experiments argue against ARNO being a robust modifier of EGFR catalytic activity.
26378252 Data establish a role for cytohesin-2/ARNO as a regulator of R-Ras and integrin recycling and suggest that ARF-regulated trafficking of R-Ras is required for R-Ras-dependent effects on spreading and adhesion formation.
25736891 The authors show that Shigella flexneri IpgD phosphatase activity is required for recruitment of the ARF6 guanine nucleotide exchange factor (GEF) ARF nucleotide binding site opener (ARNO) to bacterial entry sites.
24618737 inhibiting cytohesins or ARNO as cytoplasmic activators of EGFR and IGF-I in colorectal cancer resulted in anti-proliferation, reduced invasion, decreased migration, and suppressed growth in vivo and in vitro.
24581425 Cytohesin-2 constitutively suppresses platelet dense granule secretion and aggregation by keeping ARF6 in a GTP-bound state
24083777 Phosphorylation of Ser392 of ARNO stabilized the C-terminal alpha-helix via formation of salt bridges between phospho-Ser392 and Arg390, Lys395, and Lys396.
23545718 There is an association between cytohesin-2 expression and overall survival and disease-free survival in patients with hepatocellular carcinoma.
23288846 The N termini of a-subunit isoforms are involved in signaling between vacuolar H+-ATPase (V-ATPase) and cytohesin-2
23255605 Kinetics of interaction between ADP-ribosylation factor-1 (Arf1) and the Sec7 domain of Arno guanine nucleotide exchange factor, modulation by allosteric factors, and the uncompetitive inhibitor brefeldin A
23095975 Arf6/ ARNO signaling mediates phospholipase-D, ERK1/2 and cofilin activation in pancreatic beta-cells.
22659138 Expression of CYTH2 mutant deficient of the EFh2 domain in cells also inhibits Arf6 activation and neurite extension.
22454518 The PH domains of cytohesin 2/ARNO and cytohesin 3/GRP1 are responsible for the differential effects of these proteins on cell adhesion to fibronectin.
22341462 ARNO in turn triggered WAVE regulatory complex recruitment and activation, which was dramatically enhanced when ARNO cooperated with Salmonella SopE.
22002459 role for endothelial ARNO in VEGF-dependent initiation of angiogenesis by regulation of VEGFR-2 internalization in endothelial cells, resulting in the activation of the Akt pathway, vessel permeability, and ultimately endothelial proliferation
21307348 Data that aldolase forms a complex with ARNO/Arf6 and the V-ATPase and that it may contribute to remodeling of the actin cytoskeleton.
21118813 Arno behaves as a bistable switch, having an absolute requirement for activation by an Arf protein but, once triggered, becoming highly active through the positive feedback effect of Arf1-GTP.
20525696 cytohesin-2, through a previously unexplored complex formation with paxillin, regulates preadipocyte migration; paxillin plays a previously unknown role as a scaffold protein of Arf guanine-nucleotide exchange factor
20153292 Specific motifs of the V-ATPase a2-subunit isoform interact with catalytic and regulatory domains of ARNO.
20016009 protein-protein interaction mediated by ARNO coiled-coil domain required for ARNO induced motility; coiled-coil domain promotes assembly of multiprotein complex containing ARNO and Dock180; assembly of complex requires coiled-coil domain, GRASP and IPCEF
17623778 data suggest cells ruffle upon CaSR (calcium sensing receptor)stimulation via a mechanism that involves translocation of beta-arrestin 1 pre-assembled with the CaSR or ARNO (Arf nucleotide binding site opener)
17398095 Study shows that three related Arf-like GTPases Arl4a, Arl4c, and Arl4d, are able to recruit ARNO and other cytohesins to the plasma membrane by binding to their PH domains irrespective of whether they are in the diglycine or triglycine form.
16484220 The transport and regulation of ARNO in polartized epithelial cells, and its interactions with ARF6 in endocytosis are reported.
16027149 Endogenous levels of ARNO/cytohesin-2 present in HEK293 cells are sufficient and necessary for sustained activation of the MAP kinase signaling pathway
15277685 the N-terminal coiled-coil and parts of the Sec7 domain of cytohesin-2 are required for serum-mediated transcriptional activation in nonimmune cells
12920129 cytohesin 2 binds to IPCEF1, which modifies its activity
12641750 The overexpression of ARNO, another mammalian GEF, produces extensive neuritogenesis in Aplysia neurons

AA Sequence

MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRK      1 - 70
KFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNL     71 - 140
VQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGL    141 - 210
ERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRR    211 - 280
WFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGN    281 - 350
HMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP                        351 - 400
//

Text Mined References (54)

PMID Year Title
27203102 2016 Lack of Evidence that CYTH2/ARNO Functions as a Direct Intracellular EGFR Activator.
26378252 2015 ARF-GEF cytohesin-2/ARNO regulates R-Ras and ?5-integrin recycling through an EHD1-positive compartment.
25736891 2015 Shigella flexneri regulation of ARF6 activation during bacterial entry via an IpgD-mediated positive feedback loop.
25416956 2014 A proteome-scale map of the human interactome network.
25326380 2014 Arf6 guanine nucleotide exchange factor cytohesin-2 binds to CCDC120 and is transported along neurites to mediate neurite growth.
24618737 2014 Cytohesins/ARNO: the function in colorectal cancer cells.
24581425 2014 Cytohesin-2 phosphorylation by protein kinase C relieves the constitutive suppression of platelet dense granule secretion by ADP-ribosylation factor 6.
24083777 2013 Effect of Ser392 phosphorylation on the structure and dynamics of the polybasic domain of ADP ribosylation factor nucleotide site opener protein: a molecular simulation study.
23545718 2013 Cytohesin-2 as a novel prognostic marker for hepatocellular carcinoma.
23288846 2013 The N termini of a-subunit isoforms are involved in signaling between vacuolar H+-ATPase (V-ATPase) and cytohesin-2.
23255605 2013 Kinetics of interaction between ADP-ribosylation factor-1 (Arf1) and the Sec7 domain of Arno guanine nucleotide exchange factor, modulation by allosteric factors, and the uncompetitive inhibitor brefeldin A.
23095975 2012 Phagocytic NADPH oxidase links ARNO-Arf6 signaling pathway in glucose-stimulated insulin secretion from the pancreatic ?-cell.
22659138 2012 Arf6 guanine-nucleotide exchange factor, cytohesin-2, interacts with actinin-1 to regulate neurite extension.
22454518 2012 Phosphoinositide specificity determines which cytohesins regulate ?1 integrin recycling.
22341462 2012 Salmonella virulence effector SopE and Host GEF ARNO cooperate to recruit and activate WAVE to trigger bacterial invasion.
22002459 2012 ARNO regulates VEGF-dependent tissue responses by stabilizing endothelial VEGFR-2 surface expression.
21307348 2011 Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution.
21118813 2011 Kinetic studies of the Arf activator Arno on model membranes in the presence of Arf effectors suggest control by a positive feedback loop.
20525696 2010 Cytohesin-2/ARNO, through its interaction with focal adhesion adaptor protein paxillin, regulates preadipocyte migration via the downstream activation of Arf6.
20153292 2010 Specific motifs of the V-ATPase a2-subunit isoform interact with catalytic and regulatory domains of ARNO.
20016009 2010 GRASP and IPCEF promote ARF-to-Rac signaling and cell migration by coordinating the association of ARNO/cytohesin 2 with Dock180.
17623778 2007 The calcium-sensing receptor changes cell shape via a beta-arrestin-1 ARNO ARF6 ELMO protein network.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
16484220 2006 ARNO through its coiled-coil domain regulates endocytosis at the apical surface of polarized epithelial cells.
16415858 2006 V-ATPase interacts with ARNO and Arf6 in early endosomes and regulates the protein degradative pathway.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16027149 2005 Heterotrimeric G protein-independent signaling of a G protein-coupled receptor. Direct binding of ARNO/cytohesin-2 to the carboxyl terminus of the A2A adenosine receptor is necessary for sustained activation of the ERK/MAP kinase pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15277685 2004 Discriminatory aptamer reveals serum response element transcription regulated by cytohesin-2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654833 2003 Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor.
12920129 2003 Interaction protein for cytohesin exchange factors 1 (IPCEF1) binds cytohesin 2 and modifies its activity.
12641750 2003 Regulation of neuritogenesis and synaptic transmission by msec7-1, a guanine nucleotide exchange factor, in cultured Aplysia neurons.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438709 2002 Search for the second Peutz-Jeghers syndrome locus: exclusion of the STK13, PRKCG, KLK10, and PSCD2 genes on chromosome 19 and the STK11IP gene on chromosome 2.
12052827 2002 The N-terminal coiled coil domain of the cytohesin/ARNO family of guanine nucleotide exchange factors interacts with the scaffolding protein CASP.
11850456 2002 Tamalin, a PDZ domain-containing protein, links a protein complex formation of group 1 metabotropic glutamate receptors and the guanine nucleotide exchange factor cytohesins.
11533043 2001 beta-Arrestin-mediated ADP-ribosylation factor 6 activation and beta 2-adrenergic receptor endocytosis.
10806099 2000 N-terminal targeting of guanine nucleotide exchange factors (GEF) for ADP ribosylation factors (ARF) to the Golgi.
10801341 2000 Binding of the PH and polybasic C-terminal domains of ARNO to phosphoinositides and to acidic lipids.
10748148 2000 Specific functional interaction of human cytohesin-1 and ADP-ribosylation factor domain protein (ARD1).
10708517 2000 A transcript map of the chromosome 19q-arm glioma tumor suppressor region.
10652308 2000 Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors.
10531036 1999 Regulation of ARNO nucleotide exchange by a PH domain electrostatic switch.
10198630 1999 Brefeldin A acts to stabilize an abortive ARF-GDP-Sec7 domain protein complex: involvement of specific residues of the Sec7 domain.
9925920 1998 Assignment of the human cts18.1 gene PSCD2L to chromosome 19 band q13 using a radiation hybrid mapping panel.
9550703 1998 Insulin-dependent translocation of ARNO to the plasma membrane of adipocytes requires phosphatidylinositol 3-kinase.
9510256 1998 Structure of the Sec7 domain of the Arf exchange factor ARNO.
9476900 1998 Structure of the guanine nucleotide exchange factor Sec7 domain of human arno and analysis of the interaction with ARF GTPase.
9417041 1998 ARNO is a guanine nucleotide exchange factor for ADP-ribosylation factor 6.
9050849 1997 Cytohesin-1, a cytosolic guanine nucleotide-exchange protein for ADP-ribosylation factor.
8945478 1996 A human exchange factor for ARF contains Sec7- and pleckstrin-homology domains.
8706128 1996 Alpha L beta 2 integrin/LFA-1 binding to ICAM-1 induced by cytohesin-1, a cytoplasmic regulatory molecule.