Property Summary

NCBI Gene PubMed Count 32
PubMed Score 135.76
PubTator Score 133.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.326 1.2e-06
intraductal papillary-mucinous adenoma (... 1.200 4.5e-03
interstitial cystitis 1.100 1.7e-03
lung carcinoma -1.300 2.9e-24
acute myeloid leukemia 2.300 1.5e-02
ovarian cancer 1.200 1.8e-04

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (7)

PMID Text
22815959 cytohesin inhibition has an antiproliferative effect in gefitinib-resistant lung cancer cells
21511340 findings suggest that cytohesin-1 is a key regulator of neutrophil adhesion to endothelial cells and to components of extracellular matrix, which may influence cell emigration through its dual opposing effect on beta2 and beta1 integrin activation
20018626 involvement of cytohesin-1 in the regulation of the functional responses of human PMNs, linked, in part at least, to the activation of Arf6.
19346499 demonstrate an essential role of cytohesin-1/RhoA during ameboid migration in the presence of integrins
15778383 findings reveal that mycobacteria promote their uptake through a process of "inside-out" signaling involving CD14, TLR2, PI3K, and cytohesin-1. This converts low avidity CR3 into an active receptor leading to increased bacterial internalization
12606567 Data show that CYTIP and cytoadhesin-1 are upregulated during dendritic cell maturation.
11438522 Phosphorylated cytohesin-1 is able to tightly associate with the actin cytoskeleton, and is required for maximal leukocyte function antigen-1-mediated adhesion of Jurkat cells to Icam-1.

AA Sequence

MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGR      1 - 70
KKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLN     71 - 140
LVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPT    141 - 210
VERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKR    211 - 280
RWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEG    281 - 350
NHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH                          351 - 398
//

Text Mined References (34)

PMID Year Title
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
22815959 2012 Anti-proliferative effect of cytohesin inhibition in gefitinib-resistant lung cancer cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21628335 2011 Editorial: Cytohesin-1, on the tail of two integrins.
21511340 2011 Cytohesin-1 regulates human blood neutrophil adhesion to endothelial cells through ?2 integrin activation.
20018626 2010 Cytohesin-1 regulates the Arf6-phospholipase D signaling axis in human neutrophils: impact on superoxide anion production and secretion.
19346499 2009 Cytohesin-1 controls the activation of RhoA and modulates integrin-dependent adhesion and migration of dendritic cells.
17398095 2007 The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15778383 2005 Cross-talk between CD14 and complement receptor 3 promotes phagocytosis of mycobacteria: regulation by phosphatidylinositol 3-kinase and cytohesin-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12606567 2003 Attenuation of cell adhesion in lymphocytes is regulated by CYTIP, a protein which mediates signal complex sequestration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12052827 2002 The N-terminal coiled coil domain of the cytohesin/ARNO family of guanine nucleotide exchange factors interacts with the scaffolding protein CASP.
11867758 2002 Cybr, a cytokine-inducible protein that binds cytohesin-1 and regulates its activity.
11438522 2001 Actin cytoskeletal association of cytohesin-1 is regulated by specific phosphorylation of its carboxyl-terminal polybasic domain.
10835351 2000 Cytohesin-1 regulates beta-2 integrin-mediated adhesion through both ARF-GEF function and interaction with LFA-1.
10772823 2000 B2-1, a Sec7- and pleckstrin homology domain-containing protein, localizes to the Golgi complex.
10748148 2000 Specific functional interaction of human cytohesin-1 and ADP-ribosylation factor domain protein (ARD1).
10652308 2000 Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors.
10341214 1999 EGF-and NGF-stimulated translocation of cytohesin-1 to the plasma membrane of PC12 cells requires PI 3-kinase activation and a functional cytohesin-1 PH domain.
10212218 1999 Structural elements of ADP-ribosylation factor 1 required for functional interaction with cytohesin-1.
10092663 1999 The ADP-ribosylation factor (ARF)-related GTPase ARF-related protein binds to the ARF-specific guanine nucleotide exchange factor cytohesin and inhibits the ARF-dependent activation of phospholipase D.
9756891 1998 Guanine nucleotide exchange on ADP-ribosylation factors catalyzed by cytohesin-1 and its Sec7 domain.
9693361 1998 The PH domain and the polybasic c domain of cytohesin-1 cooperate specifically in plasma membrane association and cellular function.
9653114 1998 Solution structure of the cytohesin-1 (B2-1) Sec7 domain and its interaction with the GTPase ADP ribosylation factor 1.
9614087 1998 Phosphoinositide 3-OH kinase activates the beta2 integrin adhesion pathway and induces membrane recruitment of cytohesin-1.
9110174 1997 Large-scale concatenation cDNA sequencing.
9050849 1997 Cytohesin-1, a cytosolic guanine nucleotide-exchange protein for ADP-ribosylation factor.
8706128 1996 Alpha L beta 2 integrin/LFA-1 binding to ICAM-1 induced by cytohesin-1, a cytoplasmic regulatory molecule.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8449036 1993 Assignment of human B2-1 gene (D17S811E) to chromosome 17qter by PCR analysis of somatic cell hybrids and fluorescence in situ hybridization.
1511013 1992 Cloning and sequencing of a human cDNA from cytolytic NK/T cells with homology to yeast SEC7.