Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.14
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

 GO Process (1)

AA Sequence

MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQR      1 - 70
RDELGPSTCLTACWTALCCCCLWDMLT                                                71 - 97
//

Text Mined References (9)

PMID Year Title