Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.4e-16
nasopharyngeal carcinoma 1056 8.8e-05
lung cancer 4473 4.3e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -2.600 4.3e-02
psoriasis 2.000 1.4e-16
nasopharyngeal carcinoma -1.300 8.8e-05

Synonym

Accession A8MQ03 Q86UY7
Symbols C9orf169

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (1)

PMID Text
18187620 Knockdown of chromosome 9 open reading frame 169 (C9orf169; MGC59937) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAK      1 - 70
GNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCC     71 - 140
CVIS                                                                      141 - 144
//

Text Mined References (5)

PMID Year Title
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.