Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.1e-38
nasopharyngeal carcinoma 1058 8.8e-05
lung cancer 4740 4.3e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -2.600 4.3e-02
nasopharyngeal carcinoma -1.300 8.8e-05
psoriasis 1.800 1.1e-38

Synonym

Accession A8MQ03 Q86UY7
Symbols C9orf169

Gene

  Ortholog (2)

Gene RIF (1)

AA Sequence

MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAK      1 - 70
GNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCC     71 - 140
CVIS                                                                      141 - 144
//

Text Mined References (5)

PMID Year Title