Property Summary

NCBI Gene PubMed Count 7
PubMed Score 223.59
PubTator Score 89.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSPVAPPDGRDET      1 - 70
LRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSGNVSEAPGSGRKKPERPAAIS     71 - 140
YDHSEEGLMASIEREYCR                                                        141 - 158
//

Text Mined References (7)

PMID Year Title