Property Summary

NCBI Gene PubMed Count 28
PubMed Score 592.72
PubTator Score 173.40

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (14)

PMID Text
26002733 Acyl-Carbon Bond Cleaving Cytochrome P450 Enzymes: CYP17A1, CYP19A1 and CYP51A1.
24711211 Suggest that GDF9, possibly with FSH, may play significant roles in the regulation of cholesterol biosynthesis and the expression of CYP51A1 in granulosa cells which might be a predictor for unfertilization.
24502137 The studied azoles selectively interacted with human cytochrome P450 51A1, which showed the highest affinity towards ketoconazole.
24362992 Low nucleotide variability of CYP51A1 is seen in cholesterol and bile acid synthesis and xenobiotic metabolism pathways.
24358204 Our results indicate a new link between a cholesterol synthesis gene CYP51A1 and pregnancy pathologies.
24353279 Data show that forkhead transcription factor 4 (FoxO4) interacts with sterol regulatory element binding protein (SREBP)2 and hypoxia inducible factor (HIF)2alpha to modulate lanosterol 14alpha demethylase (CYP51) promoter activity.
22180046 The new CYP51A1 inhibitor 2-((3,4-dichlorophenethyl)(propyl)amino)-1-(pyridin-3-yl)ethanol (LEK-935) on the proteome of primary human hepatocytes were analyzed.
20547249 Studies indicate that CPY51 structures from various eukaryotic organisms are strikingly similar.
20149798 The substantial conformational changes in the B' helix and F-G loop regions are induced upon ligand binding, consistent with the membrane nature of the protein and its substrate.
18676367 the liver X receptor alpha directly silencing the expression of two key cholesterologenic enzymes (lanosterol 14alpha-demethylase (CYP51A1), and squalene synthase (farnesyl diphosphate farnesyl transferase 1)) via novel negative LXR DNA response elements
18660489 Observational study of gene-disease association. (HuGE Navigator)
15611056 Plays primary roles in determining strength of interactions with azoles
12824470 In Jurkat cells HIV-1 Nef upregulates the expression of the sterol 14-alpha demethylase CYP51 gene, which catalyzes the demethylation of lanosterol during cholesterol biosynthesis
12145339 A cAMP-responsive element binding site is essential for sterol regulation of the human lanosterol 14alpha-demethylase gene.

AA Sequence

MLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPF      1 - 70
LGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFG     71 - 140
KGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCL    141 - 210
HGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDD    211 - 280
ILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLP    281 - 350
PLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLD    351 - 420
FNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHT    421 - 490
PENPVIRYKRRSK                                                             491 - 503
//

Text Mined References (31)

PMID Year Title
26002733 2015 Acyl-Carbon Bond Cleaving Cytochrome P450 Enzymes: CYP17A1, CYP19A1 and CYP51A1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24711211 2015 CYP51A1 induced by growth differentiation factor 9 and follicle-stimulating hormone in granulosa cells is a possible predictor for unfertilization.
24502137 [SPR-biosensor assay for analysis of small compounds interaction with human cytochrome P450 51A1 (CYP51A1)].
24362992 2013 Low nucleotide variability of CYP51A1 in humans: meta-analysis of cholesterol and bile acid synthesis and xenobiotic metabolism pathways.
24358204 2013 Polymorphisms of CYP51A1 from cholesterol synthesis: associations with birth weight and maternal lipid levels and impact on CYP51 protein structure.
24353279 2014 FoxO4 interacts with the sterol regulatory factor SREBP2 and the hypoxia inducible factor HIF2? at the CYP51 promoter.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22180046 2012 The effects of rosuvastatin and the CYP51A1 inhibitor LEK-935 on the proteome of primary human hepatocytes.
21269460 2011 Initial characterization of the human central proteome.
20547249 2011 Structural basis for conservation in the CYP51 family.
20149798 2010 Structural basis of human CYP51 inhibition by antifungal azoles.
19946888 2010 Defining the membrane proteome of NK cells.
18676367 2008 Regulation of cholesterologenesis by the oxysterol receptor, LXRalpha.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15611056 2005 Structural diversities of active site in clinical azole-bound forms between sterol 14alpha-demethylases (CYP51s) from human and Mycobacterium tuberculosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12145339 2002 A cAMP-responsive element binding site is essential for sterol regulation of the human lanosterol 14alpha-demethylase gene (CYP51).
11678326 2001 Localisation of lanosterol 14alpha-demethylase in round and elongated spermatids of the mouse testis: an immunoelectron microscopic and stereological study.
8975714 1996 Structure and mapping of the human lanosterol 14alpha-demethylase gene (CYP51) encoding the cytochrome P450 involved in cholesterol biosynthesis; comparison of exon/intron organization with other mammalian and fungal CYP genes.
8845856 1996 P450 superfamily: update on new sequences, gene mapping, accession numbers and nomenclature.
8809088 1996 The three human cytochrome P450 lanosterol 14 alpha-demethylase (CYP51) genes reside on chromosomes 3, 7, and 13: structure of the two retrotransposed pseudogenes, association with a line-1 element, and evolution of the human CYP51 family.
8797093 1996 Sterol 14-demethylase P450 (P45014DM*) is one of the most ancient and conserved P450 species.
8619637 1996 The ubiquitously expressed human CYP51 encodes lanosterol 14 alpha-demethylase, a cytochrome P450 whose expression is regulated by oxysterols.
8024575 1994 Occurrence of a P450 showing high homology to yeast lanosterol 14-demethylase (P450(14DM)) in the rat liver.