Property Summary

Ligand Count 16
NCBI Gene PubMed Count 30
PubMed Score 588.41
PubTator Score 173.40

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (2)

Protein-protein Interaction (3)

Gene RIF (16)

AA Sequence

MLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGVKSPPYIFSPIPF      1 - 70
LGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFG     71 - 140
KGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCL    141 - 210
HGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDD    211 - 280
ILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLP    281 - 350
PLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLD    351 - 420
FNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHT    421 - 490
PENPVIRYKRRSK                                                             491 - 503
//

Text Mined References (33)

PMID Year Title