Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.32
PubTator Score 16.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.400 2.5e-02
cutaneous lupus erythematosus -2.000 2.4e-02
posterior fossa group A ependymoma 2.200 5.2e-12
atypical teratoid / rhabdoid tumor 1.100 4.2e-03
active Crohn's disease -1.142 1.5e-02
interstitial cystitis -1.500 2.6e-04
ulcerative colitis -1.500 5.9e-07
ovarian cancer -1.400 3.4e-05

Protein-protein Interaction (2)

Gene RIF (3)

PMID Text
26845356 Our results showed that HCV infection induced expression of CYP4F12 protein, which bound to the HCV replication complex to facilitate viral replication.
18065749 3-hydroxystearate and 3-hydroxypalmitate are converted to omega-hydroxylated 3-OHDCA precursors in liver; CYP4F11 and, to a lesser extent, CYP4F2 catalyzed omega-hydroxylation of 3-hydroxystearate; CYP4F3b, CYP4F12, and CYP4A11 had negligible activity.
16112640 We conclude that CYP4F8 and CYP4F12 catalyze epoxidation of 22:6n-3 and 22:5n-3, and CYP4F8 omega3-hydroxylation of 22:5n-6.

AA Sequence

MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPT      1 - 70
EEGLKNSTQMSATYSQGFTIWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSG     71 - 140
GDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSCLDMFEHISLMTLDSLQKCIFSF    141 - 210
DSHCQERPSEYIATILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPT    211 - 280
QGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEY    281 - 350
QERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC    351 - 420
LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFR    421 - 490
FLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ                                        491 - 524
//

Text Mined References (25)

PMID Year Title
26845356 2016 Inducible CYP4F12 enhances Hepatitis C virus infection via association with viral nonstructural protein 5B.
19129222 2009 Identification of pregnane-X receptor target genes and coactivator and corepressor binding to promoter elements in human hepatocytes.
18828626 2008 Distinction between human cytochrome P450 (CYP) isoforms and identification of new phosphorylation sites by mass spectrometry.
18662666 2008 Expression of CYP4F2 in human liver and kidney: assessment using targeted peptide antibodies.
18065749 2008 Omega oxidation of 3-hydroxy fatty acids by the human CYP4F gene subfamily enzyme CYP4F11.
17980168 2007 Expression and physiological function of CYP4F subfamily in human eosinophils.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16112640 2005 Oxygenation of polyunsaturated long chain fatty acids by recombinant CYP4F8 and CYP4F12 and catalytic importance of Tyr-125 and Gly-328 of CYP4F8.
15548388 2004 Human CYP4F12 genetic polymorphism: identification and functional characterization of seven variant allozymes.
15238214 2004 Expression and induction of CYP4F subfamily in human leukocytes and HL60 cells.
15191668 2004 [Expression of cytochrome P450 enzymes in human nasopharyngeal carcinoma and non-cancerous nasopharynx tissue].
15163554 2004 Functional characterization of genetic polymorphisms identified in the human cytochrome P450 4F12 (CYP4F12) promoter region.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15078342 2004 Expression of CYP4F12 in gastrointestinal and urogenital epithelia.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752129 2002 Involvement of CYP2J2 and CYP4F12 in the metabolism of ebastine in human intestinal microsomes.
11162645 2001 cDNA cloning and expression of a novel cytochrome p450 (cyp4f12) from human small intestine.
11162607 2001 cDna cloning and expression of CYP4F12, a novel human cytochrome P450.
9068972 1997 The cytochrome P450 4 (CYP4) family.
1116264 1975 Chemical basis and specificity of chemical screening tests for urinary vanilmandelic acid.