Property Summary

NCBI Gene PubMed Count 37
PubMed Score 65.43
PubTator Score 40.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
esophageal adenocarcinoma -3.400 1.8e-02
psoriasis -1.900 1.3e-04
osteosarcoma 1.752 1.8e-05
adrenocortical adenoma -1.820 4.0e-03
adrenocortical carcinoma -2.715 1.1e-16
non-small cell lung cancer -5.268 3.6e-23
lung cancer -7.800 3.1e-08
interstitial cystitis -4.900 1.8e-03
lung adenocarcinoma -3.000 6.1e-12
posterior fossa group B ependymoma 1.300 7.7e-03
nasopharyngeal carcinoma -3.300 8.0e-05
Endometriosis -2.637 7.3e-03
lung carcinoma -4.700 8.3e-38
ductal carcinoma in situ -2.500 1.7e-02
pituitary cancer -3.500 1.5e-07
chronic rhinosinusitis -1.904 2.9e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (16)

PMID Text
26355749 the Ser207 insertion does not rescue the P450 functional activity of human CYP4B1 that has been lost during evolution.
26252103 Single nucleotide polymorphisms of CYP2C8,CYP2E1 and CYP4B1 are associated with susceptibility to gout in ethnic Han males population.
25247810 A proline residue in the meander region at position 427 in human CYP4B1 and 422 in rabbit CYP4B1 is important for protein stability and rescues the 4-ipomeanol bioactivation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19040121 Detected by polymerase chain reaction in prostate tissue.
18713828 Results demostrated an increased risk of bladder cancer associated with the CYP4B1*1/*2 and *2/*2 genotypes.
18660489 Observational study of gene-disease association. (HuGE Navigator)
15499177 Observational study of genotype prevalence. (HuGE Navigator)
12837283 CYP4B1 is a senescene-associated gene in normal human oral keratinocytes.
12142726 Observational study of genotype prevalence. (HuGE Navigator)
12142726 polymorphism in humans: evidence for a non-functional allelic variant

AA Sequence

MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKV      1 - 70
VSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKL     71 - 140
LTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHRDSS    141 - 210
YYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNR    211 - 280
RHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILG    281 - 350
DQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWP    351 - 420
DPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQL    421 - 490
VLRSKNGFHLHLKPLGPGSGK                                                     491 - 511
//

Text Mined References (40)

PMID Year Title
26355749 2015 Characterization of an Additional Splice Acceptor Site Introduced into CYP4B1 in Hominoidae during Evolution.
26252103 2015 [Association of single nucleotide polymorphisms of cytochrome P450 gene with susceptibility to gout in ethnic Han males from coastal regions of Shandong province].
25247810 2015 Identification of amino acid determinants in CYP4B1 for optimal catalytic processing of 4-ipomeanol.
22675492 2012 Genome-wide association study of circulating estradiol, testosterone, and sex hormone-binding globulin in postmenopausal women.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19040121 Detection of cytochrome P450-2A6, -3A5 and -4B1 with real-time polymerase chain reaction in prostate tissue.
18713828 2008 Possible relationship between the risk of Japanese bladder cancer cases and the CYP4B1 genotype.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15499177 2004 Human CYP4B1 gene in the japanese population analyzed by denaturing HPLC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
15006160 2004 Retinoic acid induces corneal epithelial CYP4B1 gene expression and stimulates the synthesis of inflammatory 12-hydroxyeicosanoids.
12837283 2003 Senescence-associated genes in normal human oral keratinocytes.
12695542 2003 Characterization of pulmonary CYP4B2, specific catalyst of methyl oxidation of 3-methylindole.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12142726 2002 Genetic polymorphism of the human cytochrome P450 CYP4B1: evidence for a non-functional allelic variant.
11767004 2001 The expression of cytochrome P450 enzymes in human breast tumours and normal breast tissue.
11737226 2001 Detection of cytochrome P450 mRNA transcripts in prostate samples by RT-PCR.
11669629 2001 Covalent linkage of prosthetic heme to CYP4 family P450 enzymes.
11062028 2000 CYP4B1 is a possible risk factor for bladder cancer in humans.
10768437 2000 Gene expression in distinct regions of the heart.
9498238 1998 Expression of cytochrome P450 genes encoding enzymes active in the metabolism of tamoxifen in human uterine endometrium.
9493761 1998 Xenobiotic-metabolizing cytochrome P450 enzymes in the human feto-placental unit: role in intrauterine toxicity.
9364212 1997 Detection of mRNA encoding xenobiotic-metabolizing cytochrome P450s in human bronchoalveolar macrophages and peripheral blood lymphocytes.
9202751 1997 The role of xenobiotic metabolizing enzymes in arylamine toxicity and carcinogenesis: functional and localization studies.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8694864 1996 Detection of cytochrome P450 gene expression in human placenta in first trimester of pregnancy.
8313365 1994 Quantification of CYP2B7, CYP4B1, and CYPOR messenger RNAs in normal human lung and lung tumors.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7894498 1994 Species-specific expression of CYP4B1 in rabbit and human gastrointestinal tissues.
2574990 1989 Identification of a new P450 expressed in human lung: complete cDNA sequence, cDNA-directed expression, and chromosome mapping.
2298205 1990 cDNA cloning of cytochrome P-450 related to P-450p-2 from the cDNA library of human placenta. Gene structure and expression.