Property Summary

NCBI Gene PubMed Count 64
PubMed Score 93.67
PubTator Score 101.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8297 8.5e-12
osteosarcoma 7766 2.4e-08
lung cancer 4607 8.2e-04
psoriasis 6514 1.0e-03
diabetes mellitus 1683 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Hypertension 372 4.207 2.1
Chromosome 17q12 deletion syndrome 16 3.793 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus 1.400 2.0e-03
lung cancer -1.200 8.2e-04
osteosarcoma 2.509 2.4e-08
ovarian cancer 1.500 8.5e-12
psoriasis 1.300 1.0e-03

Gene RIF (52)

AA Sequence

MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQ      1 - 70
ELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWF     71 - 140
QHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQV    141 - 210
DRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGEL    211 - 280
EKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREE    281 - 350
IHSLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH    351 - 420
NPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIP    421 - 490
IARLVLKSKNGIHLRLRRLPNPCEDKDQL                                             491 - 519
//

Text Mined References (67)

PMID Year Title