Property Summary

Ligand Count 2
NCBI Gene PubMed Count 618
PubMed Score 657.68
PubTator Score 894.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.900 1.7e-05
atypical teratoid / rhabdoid tumor 1.400 2.0e-03
Barrett's esophagus 1.200 4.8e-02
cutaneous lupus erythematosus -2.200 1.5e-03
esophageal adenocarcinoma 1.700 2.5e-02
glioblastoma 1.400 1.4e-03
interstitial cystitis -2.300 4.2e-02
intraductal papillary-mucinous adenoma (... 2.500 3.3e-04
intraductal papillary-mucinous carcinoma... 2.500 2.0e-03
intraductal papillary-mucinous neoplasm ... 3.300 1.9e-03
lung adenocarcinoma -1.600 1.1e-17
lung cancer -1.500 5.7e-03
lung carcinoma 1.100 3.3e-04
medulloblastoma 1.400 2.3e-03
medulloblastoma, large-cell 1.400 4.3e-05
non-small cell lung cancer -1.415 1.8e-13
ovarian cancer -2.600 1.5e-07
pancreatic cancer 1.600 9.6e-04
pancreatic ductal adenocarcinoma liver m... -1.054 5.6e-03
periodontitis -1.100 9.1e-14
pituitary cancer -1.200 1.4e-04
psoriasis -1.800 1.2e-05

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (654)

AA Sequence

MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGK      1 - 70
MWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSG     71 - 140
KLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQDPFVESTKKF    141 - 210
LKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQN    211 - 280
SKETESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAV    281 - 350
VQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS    351 - 420
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVL    421 - 490
KVDSRDGTLSGE                                                              491 - 502
//

Text Mined References (619)

PMID Year Title