Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.56
PubTator Score 22.94

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Gene RIF (14)

PMID Text
25150845 This review support the notion that the SNP CYP3A43this may play a role in antipsychotic response.
24595013 CYP3A43 rs472660 is not likely to be a major contributor towards variability in systemic OLA exposure among White patients
21081028 Observational study of gene-disease association. (HuGE Navigator)
20715157 No differences in genotype frequencies between cases and controls were observed, indicating that CYP3A43_74_delA is not associated with breast cancer risk.
20529763 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18566991 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16848237 Observational study of genotype prevalence. (HuGE Navigator)
16848237 analysis of the restriction fragment length polymorphism CYP3A43 gene c1047 > T in europeoid residents of West Siberia
15894682 Observational study of gene-disease association. (HuGE Navigator)
15894682 Finds CYP3A43-Pro(340)Ala polymorphism prevalence differs by race and contributes to prostate cancer risk in African Americans.
15548719 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14695544 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWNFDRECNEKYGE      1 - 70
MWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNQMPLGPMGFLKSALSFAEDEEWKRIRTLLSPAFTSV     71 - 140
KFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFGAYTMDVITGTLFGVNLDSLNNPQDPFLKNMKKL    141 - 210
LKLDFLDPFLLLISLFPFLTPVFEALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQN    211 - 280
SKETKSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDAL    281 - 350
VQMEYLDMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFS    351 - 420
KKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQPEKPIV    421 - 490
LKVHLRDGITSGP                                                             491 - 503
//

Text Mined References (25)

PMID Year Title
25150845 2015 Genetic variation in CYP3A43 is associated with response to antipsychotic medication.
24595013 2014 No influence of CYP3A43 rs472660G> A on steady-state serum olanzapine concentrations in white psychiatric patients.
21533175 2011 Eight common genetic variants associated with serum DHEAS levels suggest a key role in ageing mechanisms.
21081028 2010 Genetic variations in androgen metabolism genes and associations with prostate cancer in South African men.
20715157 2010 The frameshift polymorphism CYP3A43_74_delA is associated with poor differentiation of breast tumors.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18566991 2008 Joint effects of inflammation and androgen metabolism on prostate cancer severity.
16848237 2005 Analysis of restriction fragment length polymorphism of cytochrome P450 3A43 gene and evaluation of the incidence of CYP3A43*1B allele in europeoid residents of West Siberia.
16314882 Sequence diversity and haplotype structure at the human CYP3A cluster.
15894682 2005 CYP3A43 Pro(340)Ala polymorphism and prostate cancer risk in African Americans and Caucasians.
15548719 2004 CYP3A4, CYP3A5, and CYP3A43 genotypes and haplotypes in the etiology and severity of prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14759258 2004 An unappreciated role for RNA surveillance.
14695544 2004 First report of a genetic polymorphism of the cytochrome P450 3A43 (CYP3A43) gene: identification of a loss-of-function variant.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11726664 2002 Intergenic mRNA molecules resulting from trans-splicing.
11266076 2001 Genomic organization of the human CYP3A locus: identification of a new, inducible CYP3A gene.
11243885 2001 Cloning and tissue distribution of a novel human cytochrome p450 of the CYP3A subfamily, CYP3A43.
11160876 2001 cDNA cloning and initial characterization of CYP3A43, a novel human cytochrome P450.
11137287 2000 The human cytochrome P450 3A locus. Gene evolution by capture of downstream exons.
9890157 1998 Molecular genetics of the human cytochrome P450 monooxygenase superfamily.